SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398587|ref|YP_001329054.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398587|ref|YP_001329054.1|
Domain Number 1 Region: 298-497
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 3.4e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.000000487
Further Details:      
 
Domain Number 2 Region: 804-1027
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 5.89e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.000000551
Further Details:      
 
Domain Number 3 Region: 566-669
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.8e-30
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000836
Further Details:      
 
Domain Number 4 Region: 135-182,274-330
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.33e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00076
Further Details:      
 
Domain Number 5 Region: 38-130
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 7.85e-23
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00013
Further Details:      
 
Domain Number 6 Region: 721-804
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 2.09e-22
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00025
Further Details:      
 
Domain Number 7 Region: 183-271
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 1.96e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150398587|ref|YP_001329054.1|
Sequence length 1048
Comment hydrophobe/amphiphile efflux-1 (HAE1) family protein [Sinorhizobium medicae WSM419]
Sequence
MPSFFIDRPIFAWVVAIFIMIAGIIAIPLLPVSQYPDVAPPQISINTNYPGASSQDTYQS
VTRLIEDELNGVEGLLYFESSTSASGSVSIDATFQPGTDPSQASVDIQNRVQRVEPRLPD
PVRQQGVQVDEAGAGFLLIISLTSTDGSMDAIGLGDYLSRNVLSEIQRVPGVGRAQLFAT
ERSMRVWLDPDKMLGLNLTAADVTAAIQAQNAQIASGSIGAQPNPITQQVTAPVVIKGQL
SSPEEFGAIVLRANADGSAVRLRDVARLEIGGESYTFSTRLNGSPSAAIAVQLSPSGNAM
STSAAIKTRMDELAAFFPQGLEYSIPYDTSPFVAVSIEKVLHTLVEAVGLVFLVMFLFLQ
NVRYTLIPTIVVPVALLGTCAVMLAMGFSINVLTMFGMVLAIGILVDDAIIVVENVERIM
SEEGLTPKDATRKAMKQITGAVIGITLVLASVFIPMAFFPGAVGVIYRQFSLTMVVSILF
SALLALSLTPALCASFLKQVPKGHHHAKRGFFGWFNRGFDRTSHGYTRFVGSVIRRTGRF
MIIYLILLAAMAWAFIRLPSSFLPDEDQGFVIVMMQLPSEATANRTTEVIEQTEKIFGQE
PAVDTIVAINGFSFFGSGQNAGLAFVTLKDWSERDADNAAQSIAGRATMAMSQIKDAISF
ALSPPAIQGLGTTGGFSFRLQDRAGLGEAALAEARDQLLGLASQSKILTGVRFEGMPDAA
QVSVDIDREKANTFGVTFADINSTISTNLGSSYVNDFPNAGRMQRVTVQADETKRMQPAD
LLNLNVRNSNGGMVPLSAFANVEWVKAPTQTVGYNGYPAVRISGEAAPGYSSGDAIAEME
RLVAQLPAGFGYEWTGQSLQEIQSGTQAPLLIALSCLLVFLCLAALYESWSIPVSVIMVV
PLGVIGAVLAVTMRDMPNDVYFKVGLIAIIGLSAKNAILIIEFAKELRDQGKSLIDATLE
AAHLRFRPILMTSLAFTLGVLPLAIATGASSGSQRAIGTGVMGGMISATVLAIFFVPVFF
VFVMKIFERGRAAPEPAKQASETVSPAE
Download sequence
Identical sequences A6UEY9
gi|150398587|ref|YP_001329054.1| 366394.Smed_3398 WP_012067600.1.29075 WP_012067600.1.61285 WP_012067600.1.7720 YP_001329054.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]