SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398616|ref|YP_001329083.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398616|ref|YP_001329083.1|
Domain Number 1 Region: 132-322
Classification Level Classification E-value
Superfamily Nudix 4.33e-41
Family NADH pyrophosphatase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150398616|ref|YP_001329083.1|
Sequence length 326
Comment NUDIX hydrolase [Sinorhizobium medicae WSM419]
Sequence
MTKTIFDLHSPHPEPSTLVAFAENHLDRRSEHRPDDCVEAALKHPGAHFLAFSGAKLIVK
HDEKIIDPLFAPYELAGLEPTMDDAVLLGFLPNGEPRIAVPSGLTEETVPEPFKIADARM
LYRQQMLPEELLGQFAQGSSLIVWNANNRFCGRCGGPMDGAGGGYRRICTACGHLVFPRT
DPVVIMLTIDLERDQCLLGRSPHFAPGMYSCLAGFVEPGETIENAVRRETLEESGIRIGR
VRYHASQPWPLPHSLMIGCYAEARSTAIKRDEQELEDVRWFTRAETEAMLERATGVADTG
DEHIPPPKGAIAHQLMRDWLAWPERD
Download sequence
Identical sequences A6UF18
WP_012067628.1.61285 WP_012067628.1.7720 YP_001329083.1.44884 366394.Smed_3430 gi|150398616|ref|YP_001329083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]