SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398621|ref|YP_001329088.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398621|ref|YP_001329088.1|
Domain Number 1 Region: 8-201
Classification Level Classification E-value
Superfamily Recombination protein RecR 2.22e-69
Family Recombination protein RecR 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150398621|ref|YP_001329088.1|
Sequence length 201
Comment recombination protein RecR [Sinorhizobium medicae WSM419]
Sequence
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKIC
SCCGNVDTIDPCTVCGDERRDQAVIIVVEDVADLWALERAGAMNAAYHVLGGTLSPLDGI
GPEDLNIRALVDRVAKGGVRELIIAVNATVEGQTTAHYITDQLEGMEVRITRLAHGVPVG
GELDYLDEGTLAAALRARTAI
Download sequence
Identical sequences A6UF23
366394.Smed_3435 WP_012067633.1.29075 WP_012067633.1.7720 YP_001329088.1.44884 gi|150398621|ref|YP_001329088.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]