SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398624|ref|YP_001329091.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398624|ref|YP_001329091.1|
Domain Number 1 Region: 15-100
Classification Level Classification E-value
Superfamily YhbC-like, N-terminal domain 2.75e-22
Family YhbC-like, N-terminal domain 0.00086
Further Details:      
 
Domain Number 2 Region: 101-175
Classification Level Classification E-value
Superfamily YhbC-like, C-terminal domain 0.000000000000157
Family YhbC-like, C-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150398624|ref|YP_001329091.1|
Sequence length 205
Comment hypothetical protein Smed_3438 [Sinorhizobium medicae WSM419]
Sequence
MSDTTTAENANEPRLITETGLDRRVADIIEPVLVDLGFRLVRVRMSGQNGLTLQVMTERN
DGTMTVEDCEEVSKAISPVLDVEDPIDKAYHLEVSSPGIDRPMVRRSDFIRWQGHLLKCE
TSVLVEGRKRFRGKIVSVDEDGFRLERDQPAYGEEAGVTIPFTALSEARLILTDELIRDA
LTADKKAKAARAANENFEEEDRDIE
Download sequence
Identical sequences A6UF26
gi|150398624|ref|YP_001329091.1| WP_012067636.1.29075 WP_012067636.1.31871 WP_012067636.1.61285 WP_012067636.1.7720 WP_012067636.1.89664 YP_001329091.1.44884 366394.Smed_3438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]