SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398632|ref|YP_001329099.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398632|ref|YP_001329099.1|
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-52
Family Ribonuclease PH domain 1-like 0.0000174
Further Details:      
 
Domain Number 2 Region: 293-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.48e-49
Family Ribonuclease PH domain 1-like 0.0000097
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.09e-29
Family Ribonuclease PH domain 2-like 0.00097
Further Details:      
 
Domain Number 4 Region: 452-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.09e-27
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 557-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.1e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 6 Region: 622-706
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2e-20
Family Cold shock DNA-binding domain-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150398632|ref|YP_001329099.1|
Sequence length 714
Comment polynucleotide phosphorylase/polyadenylase [Sinorhizobium medicae WSM419]
Sequence
MFETHKVEIEWAGRPLKLETGKIARQADGAVLATYGETVVLATVVSAKAPKPGQDFFPLT
VNYQEKTYAAGKIPGGYFKREGRPSENETLVSRLIDRPIRPLFPEGYKNDTQVIITVMQH
DLENNPDVVAMVAASAALTLSGVPFMGPVGGARVGYINGEYVLNPHLDEMDESTLDLVVA
GTQDAVLMVESEAKELSEEIMLGAVVFGQKGFQPVIDAVIRLAEVAAKEPREFEPDDHSA
LENAMLSIAEEDLRKAYKITEKAQRYAAVDAVKAKVKEHFLPEGVENPAHTAEEIASVFK
HLQAKIVRWNILDTKSRIDGRDLVTVRPIVAEVGLLPRTHGSALFTRGETQAIVVATLGT
GEDEQYVDSLTGMYKENFMLHYNFPPYSVGETGRMGSPGRREIGHGKLAWRAIHPMLPTA
EQFPYTLRVVSEITESNGSSSMATVCGTSLALMDAGVPLAKPVAGIAMGLIKEDDRFAVL
SDILGDEDHLGDMDFKVAGTEAGVTSLQMDIKIAGITEEIMKVALDQAKHGRVHILGEMA
KAISESRGQLGEFAPRIEVMNIPVDKIREVIGSGGKVIREIVEKTGAKINIDDDGTVKIA
SASGKEIEAARKWIHSIVAEPEVGQVYEGTVVKTADFGAFVNFFGARDGLVHISQLASER
VAKTTDVVKEGDKVWVKLMGFDERGKVRLSMKVVDQATGKEIAAEKKDGGEAAE
Download sequence
Identical sequences A6UF34
gi|150398632|ref|YP_001329099.1| WP_012067644.1.29075 WP_012067644.1.61285 WP_012067644.1.7720 WP_012067644.1.89664 YP_001329099.1.44884 366394.Smed_3446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]