SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398731|ref|YP_001329198.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398731|ref|YP_001329198.1|
Domain Number 1 Region: 211-523
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-44
Family Extended AAA-ATPase domain 0.0068
Further Details:      
 
Domain Number 2 Region: 29-191
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.93e-31
Family ATP-dependent protease Lon (La), catalytic domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150398731|ref|YP_001329198.1|
Sequence length 532
Comment Mg chelatase subunit ChlI [Sinorhizobium medicae WSM419]
Sequence
MPYRVMRKGQWSFALSSNSGGVMVARVSTVAFQGIEGLPVDVQVMVAPGRVGMQIVGLPD
KAVAESRERVQAALHASGLALPAKRVTVNLAPADLPKEGSHFDLAIALGLMAALGAVPAD
ALSNYIVIGELNLDGTIAAVAGALPAAIGANALGKGLICPADSGPEAAWAGSEIDILAPR
SLIAIANHFRGTQVLSRPEPAVRMAAAGLPDLSDIKGQESAKRALEVAAAGNHNLLMVGP
PGSGKSMLAARLPSILPPLSPAELLEVSMIHSIAGQLPGGKLSDSRPFRAPHHSATMAAL
IGGGARAKPGEASLAHHGVLFLDEFPEFAPQVLDALRQPLETATCIIARANHRVTYPAAI
QLIAAMNPCRCGMAGEPGRSCARGPRCMADYQARISGPLMDRIDIRVDVPAVSAADLIRP
GTSEPSAAVARRVARARELQRDRFAVLGHAELTSNARSSTTVIEKIAEPDAAGLQLLRDA
AEKMKFSARGYHRVLKVARTLADLDEAPRVGRIHLAEAISYRMAGERLPVAA
Download sequence
Identical sequences A6UFD3
366394.Smed_3547 gi|150398731|ref|YP_001329198.1| WP_012067742.1.7720 YP_001329198.1.44884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]