SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150398740|ref|YP_001329207.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150398740|ref|YP_001329207.1|
Domain Number 1 Region: 9-142
Classification Level Classification E-value
Superfamily Regulatory protein AraC 2.35e-21
Family Regulatory protein AraC 0.012
Further Details:      
 
Domain Number 2 Region: 168-217
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000472
Family Tetracyclin repressor-like, N-terminal domain 0.039
Further Details:      
 
Domain Number 3 Region: 220-267
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000193
Family AraC type transcriptional activator 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150398740|ref|YP_001329207.1|
Sequence length 269
Comment AraC family transcriptional regulator [Sinorhizobium medicae WSM419]
Sequence
MPKGHFRVLPRRIAGIDVVEATTNHSFARHTHEQFGIGLVHAGAQTSLSGRGTVAAEAGD
VITVNPGEVHDGAPIGDLGRSWRMLYLDPPLVAALVNDVTEGKRSSCEFSDPVIRSPTLA
GRFRAIFAAAIAVDSPGSTLCWDELAVTLFAEAMQLAPARAPASVSRSVARAVNLIDHDP
LASVTLEDLARESGLSRFQLVRGFAKSTGLTPHAYLIQRRMDIVRRLIAGGTPLAEAATA
GGFADQSHMTRVFVRKYGFSPGAYAQAMN
Download sequence
Identical sequences A6UFE2
WP_012067751.1.7720 YP_001329207.1.44884 gi|150398740|ref|YP_001329207.1| 366394.Smed_3557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]