SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376350|ref|YP_001312946.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376350|ref|YP_001312946.1|
Domain Number 1 Region: 19-249
Classification Level Classification E-value
Superfamily Aromatic compound dioxygenase 3.27e-80
Family Aromatic compound dioxygenase 0.0000000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150376350|ref|YP_001312946.1|
Sequence length 253
Comment protocatechuate 3,4-dioxygenase subunit beta [Sinorhizobium medicae WSM419]
Sequence
MSGDQSGGENDRPETGAFFARDRAWHPPAFAPGYKSSVLRSPQKALLSLDGTLSEITGPV
FGHSMLGELDNDLIHNFAKPGESAIGERIIVHGRVLDERGRPVQDALVEFWQANAGGRYR
HRKESYLAALDPNFGGCGRAITNGDGHYCFRTVKPGAYPWPNGVNDWRPAHIHFSIFGHG
FAQRLITQMYFEGDPMIWKCPIVGAIPDRRAIEQLIAALDWGNTVPMDARAYKFDIVLRG
RRSTFFENRPEGN
Download sequence
Identical sequences A6UH83
366394.Smed_4208 gi|150376350|ref|YP_001312946.1|NC_009620 WP_011969835.1.29075 WP_011969835.1.31871 WP_011969835.1.61285 WP_011969835.1.7720 WP_011969835.1.89664 YP_001312946.1.44884 gi|150376350|ref|YP_001312946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]