SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377330|ref|YP_001313925.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377330|ref|YP_001313925.1|
Domain Number 1 Region: 231-280
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000139
Family AraC type transcriptional activator 0.011
Further Details:      
 
Domain Number 2 Region: 283-330
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000184
Family AraC type transcriptional activator 0.014
Further Details:      
 
Domain Number 3 Region: 87-212
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.0000445
Family Regulatory protein AraC 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150377330|ref|YP_001313925.1|
Sequence length 331
Comment helix-turn-helix domain-containing protein [Sinorhizobium medicae WSM419]
Sequence
MEDMKASRRKALPRIPILIGGTLHIPPAVEEKTTPPERTSPLGLEQYIAGRTLVSGDGPA
WDDMFVQVYSRLKKQEPFLVPAVAEPLIVWVISGEAIVEEREIDRDWVTNTVTVGDFFLT
RSPTPYEMRWRATGAAPFQVMHLYLSVPLFERVAKDLLGRAARPALRDVSGGKDEQLSHL
LALIHQELTAEGKGSQLFIQGLAQSLAVHLIRNYASNGSEGGRQTALPGFKLRRAVAYLE
EHLAEPFNLAKLSEAVGMSEFHFSRLFKKATGLSPSRYFIRQRVARAQLLLQETDTSIIK
IGMSVGYSSPSHFAQVFRRETGLPPSHYRRG
Download sequence
Identical sequences A6UK12
WP_011970101.1.29075 YP_001313925.1.44884 366394.Smed_5215 gi|150377330|ref|YP_001313925.1|NC_009621 gi|150377330|ref|YP_001313925.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]