SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377870|ref|YP_001314465.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377870|ref|YP_001314465.1|
Domain Number 1 Region: 96-120,153-391
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.23e-68
Family D-glucarate dehydratase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.07e-26
Family Enolase N-terminal domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150377870|ref|YP_001314465.1|
Sequence length 400
Comment mandelate racemase/muconate lactonizing protein [Sinorhizobium medicae WSM419]
Sequence
MKITSFETVRVRDFPNILWVRIHTDEGLVGLGETFFMAQTVETYIHEVVAPKLLGRDPLE
IDRISKDLTGYLGFRSTGAEMRGNSAVDIGLWDLFGKATNLPIAQLLGGFSRREIRTYNT
CAGNTYMRDARGQQTANYGIGGPRHDYDDLNGFLERADELAEDLLSEGITAMKIWPFDIA
AEKSGGQYISGPDLRKALEPFEKIRKRVGDRIDIMVEFHSMWQLTPAIQIARALEPYATF
WHEDPIKMDSLSSLKRYAAASRAPLCASETLATRWAFRDLMETDAAGVVMLDLSWCGGVS
EAKKIATMAEAWHLPVAPHDCTGPVVLAASTHLSLNAPNALVQESVRAYYKTWYAELTTQ
LPTVTNGMITIPPGAGHGVDLAPDLDRKFEVSRRSSEVQP
Download sequence
Identical sequences A6ULK2
gi|150377870|ref|YP_001314465.1| 366394.Smed_5837 YP_001314465.1.44884 gi|150377870|ref|YP_001314465.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]