SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150377926|ref|YP_001314521.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150377926|ref|YP_001314521.1|
Domain Number 1 Region: 30-252,340-391
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-31
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.049
Further Details:      
 
Domain Number 2 Region: 426-502
Classification Level Classification E-value
Superfamily ISP domain 1.3e-21
Family Rieske iron-sulfur protein (ISP) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150377926|ref|YP_001314521.1|
Sequence length 506
Comment FAD dependent oxidoreductase [Sinorhizobium medicae WSM419]
Sequence
MNVSAERTVSLWAAVEVAPDAAPLTRDEQVDVAVIGSGIAGLSVAYELALAGQKVAVIDR
GPIGSGMTARTTAHLTSICDDYFSKLIELRGHDLARLFYESQSAAIDRIEAIQQTERVAC
DFRRVDGFLFPSSATQEADLERELDAALQIGVAVERTTGLPFAGFSASPALRYAGQATFH
PLKYLRALAVAVRARGGALFADTVVEKVEETESGVRVATTSGFVVTGKWAIVATNSPIND
RVALHTKQAPYRTYAMSFEIARGVVPDALYWDTEDPYHYVRLQPGDGETDSLIVGGEDHK
TGAVDDAGERFARLGAWVRSLVPDLGAETHRWSGQVMETIDYTGFIGLNPGNNRVFVVTG
DSGEGMTHGVVASLVIRDLVLNGDSPWREAYNPSRKTARAFRDYLVENATAIKNFAEYVA
PGEIDAVEKLQPGEGAIVREGLTKIAAYRDEDGTLYKRSASCTHVGCHVHWNSLERCWDC
PCHGSHFAFDGTALNGPAVSPLSDLK
Download sequence
Identical sequences A6ULQ8
gi|150377926|ref|YP_001314521.1|NC_009621 366394.Smed_5894 WP_011970696.1.61285 WP_011970696.1.89664 YP_001314521.1.44884 gi|150377926|ref|YP_001314521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]