SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378197|ref|YP_001314792.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378197|ref|YP_001314792.1|
Domain Number 1 Region: 235-292,322-494
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.0000654
Family DeoB catalytic domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150378197|ref|YP_001314792.1|
Sequence length 553
Comment NoeB host specific nodulation protein [Sinorhizobium medicae WSM419]
Sequence
MKRIVLLLSPLVILLSPIIDAFQGVYIDPRSDAGYAVIACVAIIGLALGMIATFCYKRGA
VGNVVTAGTLAVTLFLFGDLSYGVFWRLADHIGMGGAAALAFAGLVVLILVLFKLMAAVP
RMMAAFAVALLGSTVLDRGLITEASAEESAPAVIYIVTDEMIGISGIDTRLPHGAEAKAA
LSRVFQKHGFRLHSKAFSRHILTQVSVPAALNMDYSYNFPGDRSHYAYPGEVTKFKELSL
FNLWHRQGLSVNVFQSAHLDYCKTEALVDCHTFASFDGSRFIQRQRIEGGPYRDVPPASA
SLADVKALIEGNRQSLAMAAVGFVASNLLETKETALQEWHPRSYDQLAFPYWLGQFQNMI
LDKGRGNAFFAHFLFPHSPSVYNKDCKPTNRWVERSYLTEVRGLAGQELDEARVKEYGFY
FAQTLCLAKQLDKFFNAVLSDKRFQDATIVVHGDHGSRISAGRNVETMSPRDYVDNYSAL
YAVRKPGVATGTDYRLHSVQWLNASLFRGNVSEVAPTVVGSMQSKSDDSALYAPITDPDH
VAIMPMHDFDASH
Download sequence
Identical sequences A6UMH9
366394.Smed_6260 YP_001314792.1.44884 gi|150378197|ref|YP_001314792.1| gi|150378197|ref|YP_001314792.1|NC_009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]