SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378390|ref|YP_001314984.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378390|ref|YP_001314984.1|
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily YefM-like 0.000000000131
Family YefM-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150378390|ref|YP_001314984.1|
Sequence length 92
Comment prevent-host-death family protein [Sinorhizobium medicae WSM419]
Sequence
MTSTVTTAAVSKNFGAYQDAAVREPVIITKNGRPRTVLLAYEDYLRLSRRDRRVEATADL
SDNDLAAVEKSEMKPGFDHLNAELLTDKHAAD
Download sequence
Identical sequences A6UN21
gi|150378390|ref|YP_001314984.1|NC_009622 WP_011971026.1.29075 YP_001314984.1.44884 366394.Smed_6498 gi|150378390|ref|YP_001314984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]