SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150396235|ref|YP_001326702.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150396235|ref|YP_001326702.1|
Domain Number 1 Region: 37-254
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.67e-61
Family Prokaryotic proteases 0.00000529
Further Details:      
 
Domain Number 2 Region: 216-244,283-362
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-18
Family HtrA-like serine proteases 0.032
Further Details:      
 
Domain Number 3 Region: 376-461
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000021
Family HtrA-like serine proteases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150396235|ref|YP_001326702.1|
Sequence length 465
Comment protease Do [Sinorhizobium medicae WSM419]
Sequence
MIFGHRAAAAIVLAIAISTPAMAQDTRTVPQSRAEMQLSFAPLVKQTANAVVNVYAERAV
ERRSIFAGDPFFEEFFGQRMPNRTEKQSSLGSGVIVGRNGLVVTNNHVIDGADDIKVALA
DGREFPCKLILKDDRLDLAVMKIQSDGPFDIIPIGDSDAVEVGDLVLAMGNPFGVGQTVT
SGIVSALARNQISNGDFGFFIQTDAAINPGNSGGGLIDMKGELIGINTAIFSRGGGSNGV
GFAIPANLVKVFVASAEGGNGSFIRPFVGATFEPVTSDVAEALGLERARGALVTAVVAGG
PAESAGMRPGQVVTAVNDIPVEHPDALGYRLTTVGIGHEARVTVSENGDLREITLRLERA
PETQPRDERLIEGRNPFAGAVVANLSPRLAEELRMPTSLQGVVVTEINRGSPAARIGLEP
KDIVRSVNGTAIESSKTLESVVAEDASFWRVEIERNGQIIRQFFR
Download sequence
Identical sequences A6U887
366394.Smed_1014 WP_011975191.1.61285 WP_011975191.1.7720 WP_011975191.1.89664 YP_001326702.1.44884 gi|150396235|ref|YP_001326702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]