SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150397215|ref|YP_001327682.1| from Sinorhizobium medicae WSM419

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150397215|ref|YP_001327682.1|
Domain Number 1 Region: 21-59,101-287
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.02e-65
Family Prokaryotic proteases 0.00000409
Further Details:      
 
Domain Number 2 Region: 261-368
Classification Level Classification E-value
Superfamily PDZ domain-like 5.53e-19
Family HtrA-like serine proteases 0.0062
Further Details:      
 
Domain Number 3 Region: 407-501
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000486
Family HtrA-like serine proteases 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150397215|ref|YP_001327682.1|
Sequence length 502
Comment protease Do [Sinorhizobium medicae WSM419]
Sequence
MSKRPEFFRGLALAAATALIFTNTALAQTATSRPPAGPPSVADLAEGLLDAVVNISISQN
VKGDDDNAPIPQVPEGSPHQEFFDEFFRGPGGEGGRPRTVNSLGSGFIIDPAGYIVTNNH
VIQDADDIEINFSDGTKLKAKLVGMDTKTDLALLKVEPKKPLKAVSFGDSRKIRIGDWVM
VVGNPFGLGVSVSVGVVSARGRNINAGPYDSFIQTDAAINRGNSGGPLFNMQGEVVGINT
AILSQTGMSVGIGFAVPAELAVNVVNQLKEFGETRRGWLGVRIQPVTDDIAESLKMELPR
GALVSGIIEGGPITKGEIKPGDIIIRFDGTDIAEIRDLMRTVGESPVGKAVDVVIIRDGK
EQLVRVTLGRLEDGEQLANAKPGEMPESSDAKPGEPPAAQLPASDTVLGMKLAELDTDRR
QSFGIAENVKGVVITEVQPNSPAAERRVEVGEVIVELGQEAMETPEDVTSRVTELKADGR
RNALLMIANKSGELRFVTVRME
Download sequence
Identical sequences A6UB17
WP_011976144.1.31871 WP_011976144.1.61285 WP_011976144.1.7720 YP_001327682.1.44884 gi|150397215|ref|YP_001327682.1| 366394.Smed_2014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]