SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529043452|ref|YP_008369671.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529043452|ref|YP_008369671.1|
Domain Number 1 Region: 15-134
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000777
Family Recombinase DNA-binding domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529043452|ref|YP_008369671.1|
Sequence length 368
Comment transposase [Halorhabdus tiamatea SARL4B]
Sequence
MTGREKEIVRHLSEDDLDRLLTQTDDEKVSKRLTFIKRLYKGATLEDAADDVGMSQSTGS
RWARLWNKGGLGLLTPSFGGGRPPKLDEEQRERLLDLLEEGEPWKKQEIQHLINEEFDVE
FHPNYLPRLLDDLGLSYAIPRTERPDRPENADEILDERVADAFAEDDADEPHNKQPEDDS
DEEWTLDDDVRTDGGTTVGFFDVSHPQPWDNSQRLYTVTEPTITRPLVKIDTPAAGFYAL
NGESLLQFPPNQEKEEICACLEAIREQNPGERILLVLDNFSSHICTHTRKRAHEIGIDLV
FLPVGSPHLNPIEPVWKSLKWESSPLIVEGAAEYRALLDEIFTALTDQLSFAGSWIENHL
DGFIQKLR
Download sequence
Identical sequences F7PQR9
gi|529043452|ref|YP_008369671.1| gi|529043452|ref|YP_008369671.1|NC_021913 WP_008528511.1.19926 WP_008528511.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]