SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529043553|ref|YP_008369772.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529043553|ref|YP_008369772.1|
Domain Number 1 Region: 20-133
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000502
Family Cgl2762-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529043553|ref|YP_008369772.1|
Sequence length 178
Comment transposase [Halorhabdus tiamatea SARL4B]
Sequence
MSVEELREYLTEVDGKTATQRIMVGINHKEGIPQTQLADWYDVSRTTIHNWLKRLERLEE
EPLEDVIYDEKRPGRPSKLDDDERDRLEAVLDASPTVVGYDAVMWTPKLLQRYIEDTFDV
EYSLSYVRELMHENDVTWRTADRSDTDQALQPDRESQDGSEDRTDDDPAPQRVHGCRS
Download sequence
Identical sequences F7PHM2
gi|529043553|ref|YP_008369772.1|NC_021913 gi|529043553|ref|YP_008369772.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]