SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529076537|ref|YP_008375540.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|529076537|ref|YP_008375540.1|
Domain Number - Region: 89-144
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0177
Family FIS-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529076537|ref|YP_008375540.1|
Sequence length 153
Comment resolvase [Halorhabdus tiamatea SARL4B]
Sequence
MMQGATKSNQPYSLIVVHPDELIDRANGAERIQELVDCAVDVHLAEAGMVVTSGTAIKGA
TKRALTTLSDALHPSHDHDTDATYAWSGGRPPLGFEVDGGRLVETDEYDRICTVLQQVRD
SETSKRRAAKRLGCSRGTIINALEDRPSMYGLV
Download sequence
Identical sequences S6CS31
gi|529076537|ref|YP_008375540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]