SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529076603|ref|YP_008375606.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529076603|ref|YP_008375606.1|
Domain Number 1 Region: 1080-1246
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.43e-59
Family DNA gyrase/MutL, second domain 0.0000201
Further Details:      
 
Domain Number 2 Region: 116-234,641-671
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 6.12e-29
Family Intein (protein splicing domain) 0.0086
Further Details:      
 
Domain Number 3 Region: 26-108
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000000157
Family DNA gyrase/MutL, N-terminal domain 0.0032
Further Details:      
 
Domain Number 4 Region: 681-788
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000168
Family DNA gyrase/MutL, N-terminal domain 0.0024
Further Details:      
 
Domain Number 5 Region: 438-500
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000047
Family Group I mobile intron endonuclease 0.052
Further Details:      
 
Weak hits

Sequence:  gi|529076603|ref|YP_008375606.1|
Domain Number - Region: 526-596
Classification Level Classification E-value
Superfamily Prismane protein-like 0.033
Family Acetyl-CoA synthase 0.062
Further Details:      
 
Domain Number - Region: 358-419
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0487
Family Intein endonuclease 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529076603|ref|YP_008375606.1|
Sequence length 1380
Comment DNA topoisomerase VI subunit B [Halorhabdus tiamatea SARL4B]
Sequence
MPSMQSTLGEEGIAEELAESQRQISIAEFFEKNKHMLGFDSGARALVTAVKEGVDNSLDA
CEEADIFPDVYVEIEDVGEYYRLVIEDNGPGITREQLPKVFGKLLYGSRFHKREQSLTPD
QQVLVRRDGVVDTVPIGVLCDAYLPENGEATRPIPEGIEVPSFDRETHELSWEPVTHAIR
HETTEDTYEITTEKGRTVEVTGNHSLFSLTSSGETREVKAGDLQTGDVVLAPREIPSFDE
HVESVNLLEYITTEQLDGRRVYVYGFETETLEQLREGERIRKKPSPESDRKRTYHRYNGV
DVLKDSLETNYLEKGYLPAETVIELGWEEKAADCQFKTYQVGGKETTMPVSIPLDTSFMR
LLGYYVAEGHVGDRQVGFTFGSHEKELITATEEAIAGIGGRTTTVDRARNSTRVKAFGSP
FSMFFEEACGDRAQDKQIPEFVFRSPPELQREFITALYQGDGSDSHPSNELSHTTTSERL
ARQLSVLWNMQGVLASTEVATSDNGYADDPSTRYRTKVYSEDVTLTDVFSERFPPGEQQY
KRVPTSLLADYQVGHVGRDTVPDTIPGLLLGVGIGSSPEHAEVYRELIEDALEGEYVTKP
RYVHNLKEMGLLDRDHQPTERLEEIWETIHDLHGITDTDMCLLPVKDVERTESPEYVYDI
SVPGTTGYDENFVVVNDGALSVKNSRGQQGIGISAAVLYSQLTSGKPAKITSRTKGSEEA
HYFELIIDTDTNEPEIDVDETTAWDRPHGTRIELELEANLRARQQLHDYIKHTAVVNPHA
RIEFHEPNMAEPAKFERVEGADLPAETEEIRPHPHGVELGTLLKMLEATDSYSVSGFLQG
EFTRVGGKTSEKVLDNFRDRYDGREMAWRPPQVHEGDVEVAVRAAVANKSKDATKSFARE
VADAVDDRERLAHHELRAIVDEAAEAAAEGFGTTFGSTVREKATAAAWAQIIGDTDEADQ
RETLASDLYGLVDRATSDRKDDATIEGLADRIAAKFEDSDDERHRATREELAEYVERAAE
NTEEYDDATIGETARENVLEEIWGVMATVPDDVPNVSTLADDRDAAAELLEAMRETDIIA
PPTGCLAPISERLVEEGLRKEFDADFYAASTRDASVHGGDPFIVEAGIAYGGELEEGGPV
DVMRFANRVPLVYQRGACATTDVVKTINWRNYGLDQPGGSGIPNGPAVVMIHVASTNVPF
TSESKDAIANIPEIEDEIELAIREAARELKSFLNERRSRRQRREKQDKLGTILPEMATKL
AAVTGRAELHIDDSLARIMNNVLLERQREDGTVRLVVENNDTTNADVEITDIVTAEPANV
EADADDARVVEMDGEWFIKWSPTVSSGDDAALTYEVSDDAEFDISIDGIAEEKLTVDGEQ
Download sequence
Identical sequences S6D1B4
gi|529076603|ref|YP_008375606.1| WP_020935910.1.19926 WP_020935910.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]