SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529077003|ref|YP_008376006.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529077003|ref|YP_008376006.1|
Domain Number 1 Region: 445-584,1002-1232,1260-1307
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.51e-81
Family DNA polymerase I 0.00016
Further Details:      
 
Domain Number 2 Region: 58-455
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.23e-63
Family DnaQ-like 3'-5' exonuclease 0.00018
Further Details:      
 
Domain Number 3 Region: 583-692
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 6.02e-17
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.018
Further Details:      
 
Domain Number 4 Region: 881-963
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000145
Family Intein endonuclease 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529077003|ref|YP_008376006.1|
Sequence length 1321
Comment archaeal DNA polymerase I, intein-containing [Halorhabdus tiamatea SARL4B]
Sequence
MTDSGEQRGLGEFADGDRPAAEARAVAGNGGHEASVVDAEEWRYPEAEGTVEFEVTQVDY
TIEGGGSDEYPVLHVFGRTDDRALVHVQVYEFRPYFYAPAGNVDQERLASYDSVTGWERT
GKDGEPYESIRGEHLVRIFGRTPRDVGQIRDDFDHYEADILFPNRLLIDKDITSGVRVPE
RRTENGTIRIPHDEIEAIDYDAEARVNTFDIEVEDRSGFPEDGEEPIICLTSHDSYRDEY
VVWLYDSPVGIDPPEALDRYEPLEDDFEADVRVFDEEEAMLEAFLDYIEETDVDIMTGWN
FSDFDAPYFIDRLQELDPGTDRNLDMNRLSRVNEVWESDWQGPDIKGRVVFDLLRAYKRT
QFTELDSYRLEDVGQAELGAGKETYTGDIGTLWEDDPERLLEYNLRDVELCVELDRKQDI
IAFFEEVASFVGSKLEDAPTPGDAVDMYVLHKAFGNFVLPSKGTVESGEEFEGGAVFEPI
SGIKEMVSVHDLKSLYPMCMVTINASPETKVDPETYDGETFRAPDPSGQHFRTEPDGIVR
EMVEELLSEREEKKALRNDHDPGTEAYELYDRQQGAVKVIMNCFTPDTEVLTPAGVQNIR
DLNVGDDVYSIDPDTLEVQVKPVTETWEYPEYDGELVDIGTSKIDFSVTPNHRMLVRKNE
TNGISWDEDDYRFVEAGDLDDATNYQLPHDWSMNHGDPIDDVDLTEWIDGDYEVWVRPSV
HGHTFTAELGWTPRRVPKADAGEVGYVFTAEEFEEHREYIESVCEYNFIHRESGRKWIPR
MYDGDDFLELLAWYITEGNVYTSEEKDFGANHRGSATTVKIAQQTETVTDGGSPDDTDHA
EIGQLLDRMDFDYYVDDRAYQFTSALLGDLLRDVAGEGSAEKHIPEFVFDLDESQKRRFL
KTLISGDGDRQTGSWRYTTSSERLRDDILRLCTHLGYTANYNRDSGSWRIYVTEDSKNTL
RMHRSAERSRADNGVYSITVADNHTVLAGRNGKFQWVGQSLYGVSGWDRFRLYDKDNAAA
VTATGRSVIEYTESAVNDLGYDVTYGDTDSVMISMGTDMSVEDAIDRSFEIEEAINASYD
EFARETLQAEEHRFQIEFEKLYRRFFQAGKKKRYAGHIVWKEGKDVDDIDITGFEYQRSD
IAPITKRVQKEVLDLIVTEGDVEAVTEYLHDVIEDFQAGNVDVEDVGIPGGIGKRLNNYD
TDTAHVRGAKYANLLLGTNFQRGSKPKRLYLKKVHPDYYERIEAERDLDPSRDALYGEFK
RDPDVICFEVAEQLPAEFEVDWEKMLEKTLRGPIARVIEALGVSWQEVKSGQEQTGLGQY
M
Download sequence
Identical sequences F7PMU1
gi|529077003|ref|YP_008376006.1| WP_008527294.1.19926 WP_008527294.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]