SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529077122|ref|YP_008376125.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529077122|ref|YP_008376125.1|
Domain Number 1 Region: 579-894
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 3.97e-72
Family RNA-polymerase beta-prime 0.0000201
Further Details:      
 
Domain Number 2 Region: 91-213,543-582
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.41e-29
Family Intein (protein splicing domain) 0.028
Further Details:      
 
Domain Number 3 Region: 41-92
Classification Level Classification E-value
Superfamily beta and beta-prime subunits of DNA dependent RNA-polymerase 0.0000000000389
Family RNA-polymerase beta-prime 0.0052
Further Details:      
 
Domain Number 4 Region: 366-430
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000315
Family Intein endonuclease 0.043
Further Details:      
 
Domain Number 5 Region: 287-352
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000034
Family Intein endonuclease 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529077122|ref|YP_008376125.1|
Sequence length 904
Comment DNA-directed RNA polymerase subunit A'' [Halorhabdus tiamatea SARL4B]
Sequence
MTDTPTEYDPMNRYGTVDTDIAAVVEDTDLPRRLKTRVYEAIEDRDGVTIEQADDIAKAV
ESRYLDTRVDPLDPVGTVSAQSIGEPGTQMSIPGDERVIVRRDGETDVTEIGSLVDGLTS
VRETTTVEGHEVISAPEGMEVPSLRADERVEWKPLEQVSRHEAPDELLRFELESGRTIRA
TKAHSFVTREDNEIIPVEGSNLDDGDWLPVVRSLDGDEQDSVDLREYLPASDYWYTSTLT
DGGTATLPGGEDQIRNKRQALEAGEIEEHAVYPVQGTVGLPEQFPLDEETGFFVGAFLAE
GNLTDHYVSISNVDETFQNRVRAFAERFDLSVNEYENDSGFATGYDVRVNGTVLADFLRE
VCTVDGEKAVPDFAFGATSSFVRGLLSAYFSGDGNVGKNAVRASSTSDELIDGVTLLLAR
FDIYATFGTQEDSKTLRVPKKFVPAFADRIGMVGERGNELEDLAADVDTDGPDTTDQLPN
FGDSLKQAAEAAGIPSRQVNSAHKRQRVGRNRLVSLVEQIDQAAEERPPQLDALERAVDG
DVVWERIESIQTVEPEGEYVYDFSVAGLETFTTAQGVVTHNTMNTFHYAGVAEIDVTQGL
PRLIELVDARKEPDTPMMTVHLDGEYATERERAHEVVWKIEATRILALGDISTNVADMAV
QINLNPDTLEERWPTADSVDAVAEEIANTIESQLGVETQRTETVIQFGPEEPSYRDLLQL
VEELREIVFKGIEEVSRVVIRKEEMDDGEEEFILYTEGSAFGDVLSIEGVDASRTTCNNI
HEIYSNLGVEAAREAIIDETMNTLEEQGLDDVNVRHLMLVADIMTNNGVIESIGRHGISG
SKDSVLARAAFEVTVSHLLDAAIHGEIDALDGVTENVIVGKPIKLGTGDVNLRMGSHTGG
GAAD
Download sequence
Identical sequences F7PP17
WP_008527858.1.19926 WP_008527858.1.30395 gi|529077122|ref|YP_008376125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]