SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529077212|ref|YP_008376215.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529077212|ref|YP_008376215.1|
Domain Number 1 Region: 99-415
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.57e-25
Family Galactose oxidase, central domain 0.026
Further Details:      
 
Domain Number 2 Region: 455-508
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000981
Family Type I dockerin domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|529077212|ref|YP_008376215.1|
Sequence length 509
Comment FG-GAP repeat-containing protein, possibly sugar-related [Halorhabdus tiamatea SARL4B]
Sequence
MLTGLAGAGAIGICGTTISTARAAESAGLHQQAKLAAHDVDPADRFGDSVAVSDNGTTVL
VGVSEDEDPNGERAGSAYVFERSNETWRPQAKLTAEDGDTRDYFGDAVAVSSDGTTALVG
AATDEDPNGERAGSAYVFERSNGEWHQRAKFIPDDGDGDDYFGVSVAVSGDGTTALVGAQ
SDEDPNGDYAGSAYVFRRANDEWSQQTKLTAEDGEPFAFFGISVAISSDGTTVLVGGPNG
RNSNDDNGGATYVFDRSDEKWNQRAKLTAGDGNLGDSFGDAVAVSGDGTTAIVGGRGDEN
PSGTESGSVYAFERSSDEWSQRTKFTAEDGDSPDFFGNAVAVSSDGTTALVGAIGDDDPN
GENAGSVYAFRRSNDEWSQQTKLTAEDGDANDSFGDAVAVSSDGTTALVGAIGDENPNGE
EAGSAYVFESGLSSPGTPAVTGETPATDPNDDGRYEDVNGDGAFDIADVSALFRNYRSEA
VQNRPERFDFNGDETSDIVDVIALLARLL
Download sequence
Identical sequences F7PM90
gi|529077212|ref|YP_008376215.1| WP_008527255.1.19926 WP_008527255.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]