SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529077265|ref|YP_008376268.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529077265|ref|YP_008376268.1|
Domain Number 1 Region: 81-193
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00000000000000108
Family Tetracyclin repressor-like, C-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 3-76
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000267
Family Tetracyclin repressor-like, N-terminal domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529077265|ref|YP_008376268.1|
Sequence length 197
Comment transcriptional regulator, TetR family [Halorhabdus tiamatea SARL4B]
Sequence
MVDPLERSFSETDEEIMRGTYRALREHGYADLTIEQIADEYGKSTAAIHYHYDTKDDLLA
AFLDYVIDQFVSTIHEVETTDPAERLDLLLDKLLVDPEDHQDFLIALLEMRSQAPYKEAF
GERFRQNDEYVRYLLETVIDHGAKKGVFADVDSEHVARAIMTIVDGARTRAVIHDETEAL
ATARRAVEEYVDAVLFE
Download sequence
Identical sequences F7PIZ1
gi|529077265|ref|YP_008376268.1| WP_008525661.1.19926 WP_008525661.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]