SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|529077448|ref|YP_008376451.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529077448|ref|YP_008376451.1|
Domain Number 1 Region: 4-66
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000524
Family ROK associated domain 0.09
Further Details:      
 
Weak hits

Sequence:  gi|529077448|ref|YP_008376451.1|
Domain Number - Region: 107-143
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0141
Family Tetracyclin repressor-like, N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|529077448|ref|YP_008376451.1|
Sequence length 174
Comment transcriptional regulator [Halorhabdus tiamatea SARL4B]
Sequence
MLEKPQMAALYTAARDTISTVPELQDHVELTKSTVYEYVAALQRAGLLSEVETDGSAKSY
TAHEFTVTLEVDGMVVEITPDVVEVLSHQHSLPEIEGFLEQYGLGTLAAFIDLAYEHAAG
EVTTRMIADILDVSRGSAYDMLEHVGRILDIGDEPTTDHATDLSDDERDALLER
Download sequence
Identical sequences S6D2D5
gi|529077448|ref|YP_008376451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]