SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529077481|ref|YP_008376484.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529077481|ref|YP_008376484.1|
Domain Number 1 Region: 3-72
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000597
Family Paired domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529077481|ref|YP_008376484.1|
Sequence length 92
Comment conserved hypothetical protein (DUF433) [Halorhabdus tiamatea SARL4B]
Sequence
MSSIVRTEDILGGEPRIEGTRIGVRHVAGKVVDAGYAPAYVADQLDISLGAVYEALSYYY
DNIEEIRAVERENAETRDRLRESSLQPKEPVS
Download sequence
Identical sequences C7NMB0 F7PM72
WP_008527194.1.19926 WP_008527194.1.30395 WP_008527194.1.40337 gi|529077481|ref|YP_008376484.1| gi|257052218|ref|YP_003130051.1| 519442.Huta_1142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]