SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529077625|ref|YP_008376628.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529077625|ref|YP_008376628.1|
Domain Number 1 Region: 1086-1176,1223-1333,1706-1726,1760-1941,1979-2014
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.98e-100
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.006
Further Details:      
 
Domain Number 2 Region: 1332-1451,1632-1704
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.35e-41
Family Intein (protein splicing domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 636-736,861-877,1036-1100
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.53e-27
Family Intein (protein splicing domain) 0.0079
Further Details:      
 
Domain Number 4 Region: 160-261,295-311,529-594
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.51e-26
Family Intein (protein splicing domain) 0.035
Further Details:      
 
Domain Number 5 Region: 2012-2117,2155-2171,2367-2431
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.3e-24
Family Intein (protein splicing domain) 0.013
Further Details:      
 
Domain Number 6 Region: 384-475
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000000907
Family Intein endonuclease 0.01
Further Details:      
 
Domain Number 7 Region: 947-1039
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000000272
Family Group I mobile intron endonuclease 0.089
Further Details:      
 
Domain Number 8 Region: 1536-1649
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000000964
Family Intein endonuclease 0.023
Further Details:      
 
Domain Number 9 Region: 2431-2479
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 0.0000119
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.022
Further Details:      
 
Domain Number 10 Region: 2243-2324
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000147
Family Intein endonuclease 0.016
Further Details:      
 
Weak hits

Sequence:  gi|529077625|ref|YP_008376628.1|
Domain Number - Region: 2156-2235
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0408
Family Group I mobile intron endonuclease 0.073
Further Details:      
 
Domain Number - Region: 758-787
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0493
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529077625|ref|YP_008376628.1|
Sequence length 2728
Comment ribonucleoside-diphosphate reductase [Halorhabdus tiamatea SARL4B]
Sequence
MSDAELSVDEVTLPIKRTEGETLADRLTDNAYQNILPARYLRKDADGELVEGQEDLFERV
AKNIALAEAVYEARNQDVEITVTPDQLKPDHPRRDELAEEVFGKGTSLSDDAETTLSVYN
VNKFAYETVVPELPADVREHVEETATAFQDLMEDLSFMPNCVPPASRVAAQGGLKPLGDI
EPGERVYDDQDGTARVDSKFENGEKLVTEIETESGYTVQATPEHYFRVISASGEYEWRQV
KDLQPDDVIALQKNFLDDEGTTASLLPPMAADGGTVAAETTDFGRPRGDIDMPASMTPAL
AEWLGLYVGDGTARESGVRVAFDEQDDDLVEYWGELTESVFGFEPTTRHRNDAACVVGQA
GRRDLYDHLDQNDLLKDASKTAAVPDAVLESGRTCIETFLSGLFEADGTVGERAIELYTH
SELLADQVQKLLLGLGIRSSVSEKRDGYRVTIRKNVCGKRFVERVGFLSERKQTDAKRFE
NVAENATSIEIPNQTDRLHEWFQQSDLGHDAYRDLSQFLIDPDSEHHQEIGVGIFRRYAE
KYPELWNSPVAEFVERDQFYERVSTVDDVGRMAVEDMQVPRRNTYVVEGFVSHNSPTLMN
AGDELQQLSACFVDSPEDDIDDIHQTAKEAAQVFQCLTDDTNVYVEGKGVVSIADVEPGD
RIVQRNGDDHQVRNVDETHAYDDSPVNRVETEAGVELTGTPNHKLLVDGDWTRIDEIEPG
DTLSLRLDWIDDVDATTELTTVAGGAQWVENRTVSNDDILELYADGHSDYEIADRLDSSA
STIQRRRSLELGLDPNGSGGRPGGNVSFDESEFEALYDGGHSDGEIAKELGVSTRSVARY
RQNNSLDANGEAVKVVDQPTELTPALAELVGMWVGDGSKHEDGIRFHLNREETLEHADRL
ARDLFDVGLDWRWDEGCYEAVVHSHEVKRWWLANFGDAKPDATSASVPESVQQADRETIG
AFLRGLYSTDGSLQKDVYPRLWSSSAELIDDVQQLLLGLGVPAIKWEYDTEDRDYFNVGP
TGGQGLEQFQDLIGFVDSRSETMAETLASIDSEGPSVGTRDGSTWHVPVEAVEDAGTATV
YDVTVADNHEYVASSVVSHNSGGGMGYAFWRLRPYGDAVGSTGGIASGPITFMRTYDQMC
ETIAQGGARRGAQMGVMRVSHPDVIQFIHAKNKDVSLARTLRLNDPDDFTHNSFADALEE
ARELIDDEGRVPEHLRNAVEGHLSNFNISVGITDDFMEALQNDEEFTFTNPRTGDPHIVT
EETKELYDMFGLGEYVEVGEELSIPAAELWDDIVEGAHENGEPGVIYLERANKEHSFDVE
EHPDHRILATNPCVTGDTLISTDNGLVPAEDLYEQGVAQDVVVDGRLSEDSVKEASSVFK
TGEKDVYELTTEEGYELRLTADHRMMTDDGWVEAQNLEPGDTVHVQNRKGEFGQHGSVEE
GRVLGWLVGDGHLKHGEERAVLNFYDEDTTISERFADDVNEIVREPFGNADYEVGVSDIS
RGDDYRGAQALEQRIRSARLYEYAEETGLAEEKLQVPDAVMRGSEEMARGFLRALFSADG
SVQGNVEKGVSVRLASVDADFLKEVQQLLLNFGIASKVYEDRKEPGTVELPDGTGDTAEY
ETEGFHELVVVKDNLVRFGEEVGFLLDTKDVALDERLAEYDRGPYSESFEATVESVEYDG
HEAVYDLTEPDTHSFVANGLVCHNCGEQPLEEYEACNLGHINLSTLAAGDAPDWRVWSTR
HAEEYENFEAAVEAYLEEAIDVEELEYRIETATRFLENVVTMSDFPVEKIEEKVRNMRKI
GLGIMGLAQLFIQLGVKYGSDEGDAIAGQLMQKINHDSKWASHELAEERGVFNDWEDSKY
ADPTEYREWFEHYVGEDADDFEDGFAIRNHNTTTIAPTGTTSMVGNTTGGCEPVYNVAYY
KNVSDDVQGDEMLVEFDDYFLRVLEENGIDVDAVKQEAQEQMAANEFDGVEGLSTVPDAI
GELFVTTGDLSPNQHASIQCTLQDGVDSAISKCLEEGTLVQTDSGVRPIESFVDEDPEPG
EFTDVDEDVTIDGVQVESQYYAGEKDATRVRVDNGTEIVGATDSHKVLTPSGWTVLGDLQ
PGDHVVGRHVESHGEGGASIDAGPVCDVAFDGGTATVVGNSSRSPHEKDVTLPDRMSPRL
AKFLGMYAADGSAIDSRYGIEISTASKAVRDEARELFEELFDREPTVEEDTRRGDERKTV
YGVQLNSKPVWEFVTELCGSGAYEKRVPRTVLRGGPDEKLAFVNGVTLDGYVSSQSLVVY
GGMSERLADGVAELLRSFGVPKVYVGTKWVKESSAYAYQVHVTNEAQELVTPIEQHKRVD
RFDQRYRVYVSPDRVDKTEFNSRSPEYYAARNFEYRGRNYMFNTTAEQLGITDAPPLYEV
TDVEDAGTREMYDIELAGPHEYVVGGLVSHNTVNAPNDSTIEDAKDVFEYIYEHGGKGVT
YYRDGTRSKQVLTTRADNTDFADMDVEEVIAQIEAVFGGIEAFLEDDDVQAVVDDEIEAL
VELADGDYEEFAKKRPRPDVLHGVTQRIDTGYGKLYVNINEDPEAERPFELFANIGNSGG
FTASFTEALAKTISTAMRAGVDPGEIADELQGIRSPKVAWDKGEQIQSIPDAIGTAMRRY
LDGDIERAYPQQQTLEETADEDRETAEAEMRSTDSDTTAAPSEPTEPTGDQQELIENGES
PECPECGSMSLYYSEGCKTCESCGWSEC
Download sequence
Identical sequences F7PQI9
gi|529077625|ref|YP_008376628.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]