SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529077681|ref|YP_008376684.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529077681|ref|YP_008376684.1|
Domain Number 1 Region: 11-121
Classification Level Classification E-value
Superfamily GlnB-like 6.67e-36
Family Prokaryotic signal transducing protein 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|529077681|ref|YP_008376684.1|
Sequence length 121
Comment nitrogen regulatory protein PII [Halorhabdus tiamatea SARL4B]
Sequence
MSPATDDTDLELVMAIVRPEKLSDVKASLAEAGAPSLTVTQVSGRGSQPAKTGQWRGEEY
VIDLHQKIKIECVVESDETETVVDALREGATTGEKGDGKIFVLPVSDAVQVRTGDRGTDA
I
Download sequence
Identical sequences F7PIQ6
WP_008525533.1.19926 WP_008525533.1.30395 gi|529077681|ref|YP_008376684.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]