SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529077698|ref|YP_008376701.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529077698|ref|YP_008376701.1|
Domain Number 1 Region: 97-209
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 3.46e-17
Family Tetracyclin repressor-like, C-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 25-96
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000262
Family Tetracyclin repressor-like, N-terminal domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|529077698|ref|YP_008376701.1|
Sequence length 225
Comment transcriptional regulator, TetR family [Halorhabdus tiamatea SARL4B]
Sequence
MDTEGDAGNSTEDDPGNRAGEGDAASDTQDAIMGATYRALCEHGYANLTMQDIADEFDKS
RSLLHYHYDTKEDLLLAFVEQMVGWIGDRLAETETEDPLPRLEEYVDRFVIEPGESDRQT
FALAIIELRVQAVHHPQFREKLRSHYERNVETVAEILADGIEAGVFRDVDPERVGEAIYT
AMVGARTYQVTLGAEDATRRMRDAIAEFVATDLLVADRDVAEYAG
Download sequence
Identical sequences F7PQW1
gi|529077698|ref|YP_008376701.1| WP_008527487.1.19926 WP_008527487.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]