SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529077957|ref|YP_008376960.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529077957|ref|YP_008376960.1|
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.8e-61
Family Phosphate binding protein-like 0.0000694
Further Details:      
 
Domain Number 2 Region: 210-280
Classification Level Classification E-value
Superfamily GlnB-like 2.45e-20
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|529077957|ref|YP_008376960.1|
Sequence length 282
Comment ATP phosphoribosyltransferase [Halorhabdus tiamatea SARL4B]
Sequence
MRIALPNKGRLHDPSVELLERAGLHLVDGADRQLYARTVDDDVTVLYARAADIPEYVSDG
AADLGITGYDQAQEADRENLVSLLDLEYGQCKLVLAAPEDGDIDDPADLEGGTVATEFPN
VTRHYLEDVGVDAEITEVSGATELTPHVDIADGIVDITSTGTTLRMNRLAVVDDVLESSV
RLFAREDVADDPKVKQIEMALSSVLSAEDKRYLMMNAPESQLEEVKDVLPGMGGPTVMDI
AGTEDVAVHAVVDEQAVFETISRLKEIGASDVLVTEIERLVE
Download sequence
Identical sequences F7PNV9
WP_008527739.1.19926 WP_008527739.1.30395 gi|529077957|ref|YP_008376960.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]