SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529078096|ref|YP_008377099.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529078096|ref|YP_008377099.1|
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000125
Family Alr1493-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529078096|ref|YP_008377099.1|
Sequence length 76
Comment conserved hypothetical protein (DUF433) [Halorhabdus tiamatea SARL4B]
Sequence
MGIVRDSDHSDGTPTVEGTGIRVKDIASAYEHSGYDPDEITQLYPDLTLADVHRALAYYY
DHIEDFRSPSSEPTPA
Download sequence
Identical sequences F7PNH3
gi|529078096|ref|YP_008377099.1| WP_008527567.1.19926 WP_008527567.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]