SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529078494|ref|YP_008377497.1| from Halorhabdus tiamatea SARL4B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529078494|ref|YP_008377497.1|
Domain Number 1 Region: 9-241
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.14e-58
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.000016
Further Details:      
 
Domain Number 2 Region: 331-468,579-646
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.2e-36
Family Intein (protein splicing domain) 0.06
Further Details:      
 
Domain Number 3 Region: 674-793,888-904,1133-1197
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.16e-33
Family Intein (protein splicing domain) 0.0018
Further Details:      
 
Domain Number 4 Region: 1252-1372,1732-1774
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 6.28e-25
Family Intein (protein splicing domain) 0.028
Further Details:      
 
Domain Number 5 Region: 1772-1982
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000346
Family Extended AAA-ATPase domain 0.013
Further Details:      
 
Domain Number 6 Region: 992-1094
Classification Level Classification E-value
Superfamily Homing endonucleases 0.000000000111
Family Intein endonuclease 0.013
Further Details:      
 
Domain Number 7 Region: 1486-1560
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000259
Family Intein endonuclease 0.023
Further Details:      
 
Domain Number 8 Region: 467-522
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000536
Family SinR domain-like 0.047
Further Details:      
 
Domain Number 9 Region: 272-331
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000192
Family Extended AAA-ATPase domain 0.063
Further Details:      
 
Domain Number 10 Region: 534-574
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000198
Family Phage repressors 0.044
Further Details:      
 
Weak hits

Sequence:  gi|529078494|ref|YP_008377497.1|
Domain Number - Region: 1187-1254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00222
Family ABC transporter ATPase domain-like 0.091
Further Details:      
 
Domain Number - Region: 887-976
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00526
Family Group I mobile intron endonuclease 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|529078494|ref|YP_008377497.1|
Sequence length 2060
Comment DNA replication helicase protein MCM [Halorhabdus tiamatea SARL4B]
Sequence
MARAENTEFIDLFEEFYRDYYRNEIGELAQKYPNDQKSLFVDYQDLYRFDPDLAEDYRNK
PDQLQEYAEEALRLFDLPIDVKLGQAHVRMTNLPESTDIREIRADHRGQLVSVQGIIRKA
TEVRPKITDAAFECQRCGTLTRIPQSTGDFQEPHECQGCERQGPFRINFDQSEFIDAQKL
RVQESPEGLRGGETPQNIDVNIEDDITGDVTAGDHVRVTGVLKLDQRGNDREKSAMFDVY
MNGVSVEIEDEEFEEMDIDEADKKEIVALSEERDIYEQMTDSIAPSIYGYDQEKLAIALQ
LFSGVTKHLPDESRIRGDLHVLLIGDPGTGKCLDADTNVQLADGTTRAIGELVEANLNDP
KPVDDGVWDHASIPLPTLAPDGSLTTAEATKVWKREAPAHLYRIRTDSGRELDVTPSHPL
FVQQDGRPTAVEAEKLEEGQFVATPRSVPAPGDDRIEADYRDVLPVSGETLREIRESLSL
SQSDCGLSRATYQHYERGDRNPSRESLRAVVDAFEERLAWLKDQRDGLAGEDWETIVELR
DELSISQQSLADGMDVTQTAISYYERNEVAPDGGETVAASGVVRDRLQEALAVESTVDRL
GDLARNDVRWDRIASIEAVDPDDEWVYDLEVEGTHSYVSNGVVSHNSQILQYIRHIAPRS
VFTSGKGSSSAGLCVTGDTRIQTEDGFRQIRDVVTEDLPESVATETAAERAIDVQSFDRE
GGEMDARTSSHVWRMPEKPTRRIETEYGKELEASVNTPVLTCGSDGIEWAEISDIEAGDF
IAAPRFEDLDRSEVDVRDLLTLSTEKVRLTEESIEFLRTELTEEFGTLRDAAAALDLSED
FIYLHLKNRHVPLSKLDRMLKAIDATRSAVDFERLMVRHGESITIPESFDADLMYLLGLV
FGDGDISLDRRDGNRGMVRISNGDEALLERAADIFEAKFDKRPEIERQNDRVPCIRVNSV
TIARLFENAGMESPKKHLALAPELTVTEHGDAFLRGLMDADGSVSVRGEKGGSSVQLSTI
SETLGEQVQLMLESYGVKARLRERDRRGTSELADGHEIESGHVQYFLELYGAEIDRYAEA
IGFESIEKQTALEEIVREERRQREKIPVGSALAAVDGVAGDYYQNVNRGDNPGRARARSM
LADIDLGPVEPLVEEAVEADLRWEEVVAAVDTGEKEVFDLTVPETHNFLGNGLVTHNTAA
AVRDDFGDGQQWTLEAGALVLADRGIAAVDELDKMRSEDRSAMHEALEQQSYHPDSELLL
ADGRRVEIGNFVDQRMGERSDDVIDGVDCEILPVDDVSVHSADLDDNEVQKLPVDRVSRH
EAPEEFVRVSFSNGREVVVTPEHPMFVAADGDIDTLEARHVDEGYFVPAPRKLPNSAATV
PLEDESQNGKEKDIALPAAMSPDLAEILGFLIAEGHSYAGSAHEIGFSNQDERLLDRMDE
LMGRVFGMGSTDTTNAAGTVTKRWISTQLYRWFQENFPEFMHTARDKRIPSKVLGASEEE
IRRFLVGAFQGDGGVESEAMAFCTASPGLAEDYADALSKIGVATRIHHDDAEDSWKTYVM
GDSTERFVTKIVQPRDDRYEDAQTFVERSNETPRHHDVLPTDAARELRELRNLLGLRKTG
QFKPNLENDFGVHIGTVEAELDTLRERAEEIRSALEAADDLAAVRNAIGWSGRQLAERLE
NETTSAVHYAESGGYDAERRALLRRQALEAAKSALTEFEQRAETLESRTDFRYYRVTDVE
TLPNEGEHATEWVYDVTVEPTNTFVSQGVVLHNSISISKAGINATLKSRCSLLGAANPKY
GRFDQYEPIGEQIDLEPALISRFDLIFTVTDEPDEEADAELAEHILRTNYAGELNTHREQ
NSTPDYSAEEVESVTDTVAPEIDPELLRKYVAYAKRSCFPTMTEEAKAAIRDFYVELRTK
GSGEDAPVPVTARKLEALVRLAEASARVRLSDTVEAADAERVIGIVRSSLEDIGIDPETG
ELDADVVETGTSKSQRDRIKNIRGIIADIEEEYDEGAPVDVVIERAEEVGMDASKAEHEI
EKLKQQGEVYEPRTDHLRTT
Download sequence
Identical sequences F7PG01
gi|529078494|ref|YP_008377497.1| WP_008523979.1.19926 WP_008523979.1.30395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]