SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154684820|ref|YP_001419981.1| from Bacillus amyloliquefaciens FZB42

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154684820|ref|YP_001419981.1|
Domain Number 1 Region: 627-793
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-48
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 2 Region: 4-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.69e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0016
Further Details:      
 
Domain Number 3 Region: 143-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.14e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0018
Further Details:      
 
Domain Number 4 Region: 514-635
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.23e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154684820|ref|YP_001419981.1|
Sequence length 805
Comment hypothetical protein RBAM_003510 [Bacillus amyloliquefaciens FZB42]
Sequence
MGKKQLVLVGNGMAGVRAIEEILRVSKDEFEITIFGAEPHPNYNRILLSKVLQGDTDIQD
ITLNDWNWYKENNIQLYTGETVIKVDTENKTVITDADRIQPYDELILATGSVPFILPIPG
ADKQGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARGLLNLGMDVSVIHLAPFL
MERQLDAAAGRLLQNELEKQGMTFFLEKQTEEILGTDRVEGVRFKDGTSIEADLVVMAVG
IRPNTQLGTESGIPVNRGIIVNDYMQTDIPHIYAVGECAEHRGIAYGLVAPLYEQAKVLA
KHLCGIETKPYEGSVLSTQLKVSGVEVFSAGDFNESEDKKAIKVFDEQDGIYKKIVLRGN
QIVGAVLFGDSSEGSRLFSMIQKEADISETSKISILQPLDQEAGASMTAAMSDDEIICGC
NGVSKGAIIQAIQEKGCTSTDEIKACTGASRSCGGCKPLVEDILQYTLGSEFDASAQKEA
ICGCTSLSRDEVVEEIKAKGLSHTREIMNVLGWKTPEGCSKCRPALNYYLGMINPATYED
DRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSQDLRKIADVVDKYEIPLVKMTGGQRI
DLIGVKKEDLPKVWAELDMPSGYAYGKTLRTVKTCVGEQFCRFGTQDSMALGIALEKKFE
GLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDGGWELYVGGNGGTHLRAGDLLMKVKTN
EEVLEYAGAYLQYYRETANYLERTSAWLERVGLSHVQSVLNDPEKRQELNDRMNETLSVH
KDPWQYFLKDKKASKDLFENVVTTS
Download sequence
Identical sequences A7Z174
gi|154684820|ref|YP_001419981.1| gi|556556070|ref|YP_008725605.1| 326423.RBAM_003510 WP_011996306.1.37657 WP_011996306.1.44318 WP_011996306.1.80280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]