SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154685314|ref|YP_001420475.1| from Bacillus amyloliquefaciens FZB42

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154685314|ref|YP_001420475.1|
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Hypothetical protein YfhH 4.05e-47
Family Hypothetical protein YfhH 0.00000712
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|154685314|ref|YP_001420475.1|
Sequence length 104
Comment hypothetical protein RBAM_008600 [Bacillus amyloliquefaciens FZB42]
Sequence
MDKRYSQMTPHELQTEIAGLTEKARKAEQMGIVNELAVLERKITMAKAYMLNPEDFRPGG
VYQIEGSDDTFRIDYINGVFAWGHRSSPSDGEEALPISVLKEKK
Download sequence
Identical sequences A0A142FC64 A0A1D9PHR9 A0A1U3WRT3 A0A1W6HGE2 A0A2D3DLP2 A0A2D3KV81 A0A2H6MPT6 A7Z2L8 I2C2P4 S6FI88
gi|387897347|ref|YP_006327643.1| gi|154685314|ref|YP_001420475.1| gi|384264409|ref|YP_005420116.1| 326423.RBAM_008600 gi|452854812|ref|YP_007496495.1| gi|530613581|ref|YP_008420242.1| gi|530568617|ref|YP_008411832.1| WP_007408553.1.100906 WP_007408553.1.10180 WP_007408553.1.10479 WP_007408553.1.10853 WP_007408553.1.14108 WP_007408553.1.17514 WP_007408553.1.17976 WP_007408553.1.211 WP_007408553.1.21189 WP_007408553.1.22860 WP_007408553.1.23850 WP_007408553.1.27005 WP_007408553.1.27811 WP_007408553.1.29703 WP_007408553.1.30991 WP_007408553.1.3136 WP_007408553.1.31728 WP_007408553.1.32802 WP_007408553.1.34580 WP_007408553.1.37381 WP_007408553.1.37657 WP_007408553.1.39952 WP_007408553.1.42579 WP_007408553.1.44318 WP_007408553.1.45980 WP_007408553.1.46424 WP_007408553.1.52720 WP_007408553.1.52960 WP_007408553.1.53492 WP_007408553.1.53942 WP_007408553.1.54902 WP_007408553.1.55877 WP_007408553.1.55915 WP_007408553.1.57138 WP_007408553.1.57234 WP_007408553.1.57257 WP_007408553.1.58623 WP_007408553.1.61048 WP_007408553.1.61265 WP_007408553.1.61335 WP_007408553.1.61562 WP_007408553.1.62170 WP_007408553.1.62742 WP_007408553.1.62871 WP_007408553.1.62879 WP_007408553.1.63713 WP_007408553.1.6586 WP_007408553.1.66543 WP_007408553.1.66574 WP_007408553.1.67719 WP_007408553.1.68293 WP_007408553.1.68714 WP_007408553.1.73139 WP_007408553.1.7364 WP_007408553.1.74118 WP_007408553.1.78914 WP_007408553.1.79354 WP_007408553.1.80280 WP_007408553.1.80415 WP_007408553.1.80671 WP_007408553.1.8147 WP_007408553.1.82532 WP_007408553.1.8397 WP_007408553.1.87529 WP_007408553.1.8895 WP_007408553.1.89039 WP_007408553.1.89464 WP_007408553.1.89937 WP_007408553.1.92694 WP_007408553.1.93013 WP_007408553.1.95227 WP_007408553.1.96909 WP_007408553.1.97992 WP_007408553.1.98151 WP_007408553.1.98556 gi|549696736|ref|YP_008625433.1| gi|429504343|ref|YP_007185527.1| gi|556556599|ref|YP_008726134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]