SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154685935|ref|YP_001421096.1| from Bacillus amyloliquefaciens FZB42

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154685935|ref|YP_001421096.1|
Domain Number 1 Region: 191-590
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.86e-94
Family beta-Lactamase/D-ala carboxypeptidase 0.00000469
Further Details:      
 
Domain Number 2 Region: 56-240
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 3.01e-46
Family Penicillin binding protein dimerisation domain 0.0000383
Further Details:      
 
Domain Number 3 Region: 598-654
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000085
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0042
Further Details:      
 
Domain Number 4 Region: 656-711
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000379
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154685935|ref|YP_001421096.1|
Sequence length 714
Comment PbpB [Bacillus amyloliquefaciens FZB42]
Sequence
MPKKNKFMNRGAAILSICFALFFFVILGRMAYIQLTGKANGVELATKATEQHEKKRTIEA
SRGSILDRNGKVLAEDTATYKLIAVLDKKMTSDPKHPQHVKDKEKTAEKLATVINLDKSE
ILDILNRDGAKQVEFGSAGRDISYAKKQKIEKMNLPGISFLRDTKRYYPNGVFLSNVLGY
ADVNEKTNEIQGSLGLEKILNNYLTERDGSVTYESDKSGWKLPNSKEKITAPKNGDNVYL
TIDQKIQTFLEDSMTKVAEKYKPKKIMAAVVEPKTGKVLAMGQRPSFDPNIRNVTNYYND
LVSYAYEPGSTMKIFTLAAAIQENVFSANEKYKSGTYKVGGGPVKDWNDGAGWGMTSFHD
GLMRSSNVAFAKLANEKLGFDRFNEYLHKFGLYQKTGVDLPGEVSSKINYKYDFDKASTA
YGQASAITPIQQLQAVTAIANNGKMMKPYVIDHIVDPDTKKVVKQTKPEQVGTPISADTA
KKVRNLLGEVVTSDIGTGKPYKIEGFDVAGKTGTAQIAGTGGYLRGTSNYVFSFMGMAPK
NDPKLVIYVAVQQPQLKAGQSSSDPVAEIFNPTMKNSLHYMNIEPTEKTDSGQEETKSQK
MPDLTDKTVKSAEKEAKNEHLTPIVIGSDVAVKEQYPTAGEDVITNQKIFLKTDGKMTMP
DMSGWSRREVLQFSKVSGIHIDVSGEGYASSQSVKKGKELKENTVIKVKFKNPD
Download sequence
Identical sequences A7Z4D9
WP_012117501.1.37657 WP_012117501.1.44318 WP_012117501.1.80280 326423.RBAM_015020 gi|154685935|ref|YP_001421096.1| gi|556557283|ref|YP_008726818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]