SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154685936|ref|YP_001421097.1| from Bacillus amyloliquefaciens FZB42

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154685936|ref|YP_001421097.1|
Domain Number 1 Region: 174-569
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.52e-99
Family beta-Lactamase/D-ala carboxypeptidase 0.0000482
Further Details:      
 
Domain Number 2 Region: 52-220
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 5.76e-41
Family Penicillin binding protein dimerisation domain 0.0011
Further Details:      
 
Domain Number 3 Region: 584-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000576
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154685936|ref|YP_001421097.1|
Sequence length 639
Comment SpoVD [Bacillus amyloliquefaciens FZB42]
Sequence
MRVSNVTVRKRLLLVLLFGVIIFLIIDSRLGYVQFVMGEKLTSLAKDSWSRNLPFEPERG
EILDRNGVKLATNKSAPTVFVVPRQIQNPIKTGKLLASVLNMSEEKVYKHITKKTSIEKI
SPEGRKISNKKAKEIKALDLKGVYVAEDSIRHYPYGSFLSHVLGFAGIDNQVLLGLEAYY
DDDLKGVKGSVKFYTDAKGKKMPDEADDYTPPKDGLDMKLTIDAKVQTIIERELDNAAAK
YNPDGMIAVAMNPKNGEVLGMSSRPDFDPADYQSVDPSVYNRNLPVWSTYEPGSTFKIIT
LAAALQEQKVNLQRDHFYDKGFAEVDGARLRCWKKGGHGSQSYLEVVQNSCNPGFVQLGE
RLGKQKLFQYIKDFGFGKKTGIDLQGEGTGILFPLDRVGPVEQATTAFGQGVSVTPIQQV
AAVSAAINGGTLYTPFIAKEWVDPVTKKTVKKQSPIAKRQVISQETSKQIRYALESVVAQ
GTGRNAFVEGYRVGGKTGTAQKVKDGKYLENNHIVSFIGFAPADDPSLVVYVAVDNPKGT
IQFGGTVAAPIVGNMMRDSLPELGVKPRKNQIEKKYQWNDTKTIEVPNVVGMSVSDLESL
LVNLNIDSSGKGSKIVKQSPAAGTKVKEGSKIRVYLSEE
Download sequence
Identical sequences A7Z4E0
WP_012117502.1.37657 326423.RBAM_015030 gi|154685936|ref|YP_001421097.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]