SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154687461|ref|YP_001422622.1| from Bacillus amyloliquefaciens FZB42

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154687461|ref|YP_001422622.1|
Domain Number 1 Region: 146-344
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.07e-58
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000503
Further Details:      
 
Domain Number 2 Region: 429-561
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000501
Further Details:      
 
Domain Number 3 Region: 13-145
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.05e-32
Family Duplicated SiR/NiR-like domains 1 and 3 0.0022
Further Details:      
 
Domain Number 4 Region: 346-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.21e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154687461|ref|YP_001422622.1|
Sequence length 571
Comment sulfite reductase subunit beta [Bacillus amyloliquefaciens FZB42]
Sequence
MVNNILKAPEGPPSDVEEIKEKSDYLRGTLKEVMLDRISAGIPDDDNRLMKHHGSYLQDD
RDLRNERQKQKLEPAYQFMLRVRMPGGVSTPEQWLVMDELAQKYGNNTLKLTTRETFQMH
GILKWNMKKTIQKINAALLDTIAACGDVNRNVMCASNPHQSEIHAEVYEWSKKLSDDLLP
RTRAYHEIWLDEERVAGTPDTETEPMYGPLYLPRKFKIGIAVPPSNDIDVYSQDLGFIAI
VEEGRLIGFNVAIGGGMGMTHGDTATYPQLSKVIGFCKPEQLYDVAEKTITIQRDYGNRS
VRKNARFKYTVDRLGLENVKAELENRLGWQLDEAKPYHFDHNGDRYGWVKGVKGKWHFTM
FIEGGRVTDYENYKLMTGLREIAKVHTGDFRLTSNQNLIIGNVSSQKKKQISALIEQYGL
TDGRQHSALRRSSMACVALPTCGLAMAEAERYLPKLIDKIEDIVDENGLRDEEITIRMTG
CPNGCARHALGEIGFIGKAPGKYNMYLGAAFDGSRLSKMYRENIGEEEILSELRTILPRY
AKEREEGEHFGDFVIRAGIIKATTDGTNFHE
Download sequence
Identical sequences A7Z8R5
326423.RBAM_030600 WP_012118438.1.3136 WP_012118438.1.37657 WP_012118438.1.39952 WP_012118438.1.44318 WP_012118438.1.54902 WP_012118438.1.61562 WP_012118438.1.78914 WP_012118438.1.80280 gi|556558916|ref|YP_008728451.1| gi|154687461|ref|YP_001422622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]