SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119774023|ref|YP_926763.1| from Shewanella amazonensis SB2B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119774023|ref|YP_926763.1|
Domain Number 1 Region: 191-327
Classification Level Classification E-value
Superfamily CBS-domain pair 3.03e-26
Family CBS-domain pair 0.0037
Further Details:      
 
Domain Number 2 Region: 337-419
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.39e-21
Family CorC/HlyC domain-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119774023|ref|YP_926763.1|
Sequence length 429
Comment hypothetical protein Sama_0886 [Shewanella amazonensis SB2B]
Sequence
MDAISTGTLLLSLLVLILISAYFSGSETAMMSLNRYRLRHLASNGHKGAKRASKLLDRPD
RLIGLILIGNNLVNILASAIATIIGMRIWGDVGVAIATGLLTVVVLVFAEVTPKTVAALH
PERIAYPSSLLLKWLLVILQPLVKVMNIITSGILRLIGIRNVATNDALSQEELRTVVHEA
GALIPQRHQDMLLSILDLEKVTVEDIMIPRAEIYAINVNDDFKQINRQVVTSPHTRVLVY
RDTIDDAVGFIHLRDALRLQSKEEFSKATLLRAVKELYFIPEGTPLNVQLANFQHNKERI
GLVVDEYGDIQGLVTLEDILEEIVGDFTTSMVPTASEEIHPQEDGSLLIDASINIRELNK
EMKWELPTDGPKTLNGLILEYLEDIPSPNTSLRLEGYPIEVMEVAENMVKTVRVMPDLYQ
APDNAKKTP
Download sequence
Identical sequences A1S3Y7
326297.Sama_0886 WP_011759003.1.25267 gi|119774023|ref|YP_926763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]