SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119775149|ref|YP_927889.1| from Shewanella amazonensis SB2B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119775149|ref|YP_927889.1|
Domain Number 1 Region: 453-540
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000314
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119775149|ref|YP_927889.1|
Sequence length 592
Comment sulfate permease family protein [Shewanella amazonensis SB2B]
Sequence
MDESKGVCVSRLLSLMPGLASFKDYRKEWFKDDVRAAFSVSAVALPVAIAYAQLTGVNAL
VGLYSCVLPMMVYALFGTSRQLIVGPDAATCAVVAAVVTPLAAGDSIKHWQLAMTMTAMT
GFWCLIASRFKLGVLADFLSKPILMGLLNGVAITIIVGQASKILGFSFDERYLLDRIAAA
PGYLSQIHWATLAMSLGAVLIFLLVKRFRPTWPAAMLVIVVSTLVAWAANLEQFDVALVG
DVSINMPAFQMPAFDIGIARELVMPALNLAMVSFVSMMLTARSFAAKNGYDIDPDKEFRA
LGIANIASALSQGFAVSGADSRTAVNDASGGKTQLVSLIAALIIGIIAWLFTAPLAFIPS
AALGVVLVVASWSLLDLKTLWKLRKRDQRAFLLAMTTFVAVLLIGVIPGITLAVLLGLFQ
FLQVVMRPSDQCLGLDAKGTLRSLDGSDKAVAVPGVFIYRFNSPLTYFNASYFKRRLLER
IAAEPETPECVIIDAVPCFTHPDISVMAMLSDLYALLKRRHIRLILAGRKRQLLSWCEAQ
GIPTGEGGLLIRSDLYLALKMNQAYKQALADGQAPVLKRPVDLDLVLEHSHL
Download sequence
Identical sequences A1S763
WP_011760127.1.25267 326297.Sama_2014 gi|119775149|ref|YP_927889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]