SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119775710|ref|YP_928450.1| from Shewanella amazonensis SB2B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119775710|ref|YP_928450.1|
Domain Number 1 Region: 53-190
Classification Level Classification E-value
Superfamily CBS-domain pair 3.79e-34
Family CBS-domain pair 0.0026
Further Details:      
 
Domain Number 2 Region: 203-286
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.73e-22
Family CorC/HlyC domain-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119775710|ref|YP_928450.1|
Sequence length 292
Comment magnesium and cobalt efflux protein CorC [Shewanella amazonensis SB2B]
Sequence
MSDDIPPSSNAQKKGWLERVSQLFQGEPQNRDDLVEVIHDAEQRDLITEDTREMIQGVLE
VSDLRVRDIMIPRAQIVAIKIDSTVEELLATVIGSAHSRFPVVNDDKDHIEGILLAKDLI
KYGFNNSDEPFALEKVIRPAVVVPESKRVDVLLKEFRSQRYHMAIVVDEYGGVSGLVTIE
DILEEIVGEIEDEFDHDSVEETEIRKVNNTVFMVKALTAIEDFNEEFGTDFSDEEFDTVG
GMVAHAFGHLPERNEQISIGGIEFKVISADTRRLIQLRVKFPDPEQAEIAEI
Download sequence
Identical sequences A1S8S4
gi|119775710|ref|YP_928450.1| 326297.Sama_2578 WP_011760687.1.25267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]