SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119776416|ref|YP_929156.1| from Shewanella amazonensis SB2B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119776416|ref|YP_929156.1|
Domain Number 1 Region: 346-431
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.2e-21
Family CorC/HlyC domain-like 0.0000672
Further Details:      
 
Domain Number 2 Region: 201-336
Classification Level Classification E-value
Superfamily CBS-domain pair 3.11e-18
Family CBS-domain pair 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119776416|ref|YP_929156.1|
Sequence length 436
Comment hemolysin [Shewanella amazonensis SB2B]
Sequence
MSFFENSLIILMLIGISCFFSMSEIALAASRKIRLRQLADEGNERARKVLELQAHPGSFF
TVVQIGLNAVAIMGGIVGESAFTPHIMALLDGIVPAKWLGQFSFILSFMLVTSLFILLAD
LMPKRIAMAMPERVAVSLVGAMGLCITVLRPLVWVFNGLANGLFRMLRIPTERNDAITED
DIYAVMDAGAEAGVIDKGEQQMMENVFEMQSVPVTSAMTPRESLVFFLQSDTEEDIKRKI
AADPHSQFLLCDGQLDAIKGYVDSKDLLIKVISGQALNLKDPSLVQTCPIIPDTLSLSEA
LDYFRNNRVDFAVVLNEYALVLGVVTFNDLQSAVMGTWSLAEGEEQIVARDPSSWLVDGV
TPITDVMRAFGIDSFPQSQNYETIAGFIMFMLRKIPRRTDFVVYAGYKFEVVDIDSYKVD
QLLVTKVELPPGAEDQ
Download sequence
Identical sequences A1SAT0
326297.Sama_3284 WP_011761391.1.25267 gi|119776416|ref|YP_929156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]