SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148284009|ref|YP_001248099.1| from Orientia tsutsugamushi str. Boryong

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148284009|ref|YP_001248099.1|
Domain Number 1 Region: 170-449
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 1.83e-52
Family Tricorn protease N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 42-176
Classification Level Classification E-value
Superfamily TolB, N-terminal domain 3.4e-31
Family TolB, N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|148284009|ref|YP_001248099.1|
Sequence length 453
Comment translocation protein TolB [Orientia tsutsugamushi str. Boryong]
Sequence
MINNLSVSMTKVLKIILTIIIILFNTLSILANTTTLSSIKITKGNCTQIPIAINFFSAKS
NEEHDLSQNIVSIISNDLNISKIFAPISSDLFIETEQGVAHIPLFTAWSQINANILINGE
ITKIDSTDFKVTFVIWDVFSAKEITRKSFTFPSQLWRSTAHKIADQIYKHVTGSKGNFNT
KIVYVSESNSSNRKIRRIAIMDQDGANHNYITNGKNHVITPVFSPKNNQILYVSYHNKIP
TVRIHDLNSGNNKILASFNGITFSPRFSPDGNKILVSNSSTKNVTHIYEINLLTGKIKQL
TKGQSINTSPSYSPDGSKIAFVSDRSGSTQIYIMNDQGGNIKRLTSQPGAYTTPAWSPTN
NYIAFTKIEAGEFSIGVIKLDGSNKRIIATKYLVEGPSWAPDGKTIIFSRAYKATKSTST
KVKLYSVDYTGYNEREIQTPENASDPNWSNEYE
Download sequence
Identical sequences A5CBX4
357244.OTBS_0018 gi|148284009|ref|YP_001248099.1| WP_011944239.1.173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]