SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|148284139|ref|YP_001248229.1| from Orientia tsutsugamushi str. Boryong

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|148284139|ref|YP_001248229.1|
Domain Number 1 Region: 29-220
Classification Level Classification E-value
Superfamily Cytochrome c 6.8e-70
Family Cytochrome bc1 domain 0.00000225
Further Details:      
 
Domain Number 2 Region: 221-258
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0000183
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|148284139|ref|YP_001248229.1|
Sequence length 264
Comment cytochrome c1, heme protein precursor [Orientia tsutsugamushi str. Boryong]
Sequence
MQQIFKKISICLIILVMELIVVLSIQAEALSPKKLDWPFNGILGQLDVQAAQRGFKVYKE
VCSACHSLKYVSYRNLADIGFSADEIKAIAREYNFQDGPNDQGEMFERSGLPSDQFYSPF
PNDKAARAANNGSYPVDLSLIIKAREKGADYVYSLLTGYTAPPEEFKLEHGLYYNPYFSI
QKIAMPPPLTNHQVSYSDGTNSSVEQMAKDIVVFLQWAAEPEMTHRKSMGLKVIIFLIIF
STIFYIAKERVWSNIKDKHKNTNL
Download sequence
Identical sequences A0A0F3P6Q5 A5CCC9
gi|148284139|ref|YP_001248229.1| 357244.OTBS_0259 WP_011944365.1.173 WP_011944365.1.29834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]