SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|338730320|ref|YP_004659712.1| from Thermotoga thermarum DSM 5069

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338730320|ref|YP_004659712.1|
Domain Number 1 Region: 2-309
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.67e-78
Family Methylenetetrahydrofolate reductase 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338730320|ref|YP_004659712.1|
Sequence length 318
Comment methylenetetrahydrofolate reductase (NAD(P)H) [Thermotoga thermarum DSM 5069]
Sequence
MKVVEKIKQKRILSIEVLPPSRGQNVEEIYQVIDNLLDFDIDFINVTRHAAEVTYVETPE
GIVKVPKVKRPGTVGLTAALMKRYGIDVVPHVICYGMNKYQIEELLIDLQLIGVENVFVI
RGEYENRNIQPDQSSYKYAVELVQQIARMNKGESVLPGEEGFKTDFCIGVAAYPEKHYEA
PNLEEDLRHFKEKFEAGAQYAITQMVFDFEVYKRFIEMTKEMGINIPIIPGIKPIVSLKS
IYQIPRKFFVTIPNDFVQKMQEAKTPKEEFLIGTKYMASLVEKLLSYGVPGIHIFTMGRG
QSSRALLEAVYGKERRRD
Download sequence
Identical sequences F7YXH5
WP_013931839.1.44118 gi|338730320|ref|YP_004659712.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]