SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110678743|ref|YP_681750.1| from Roseobacter denitrificans OCh 114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110678743|ref|YP_681750.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.58e-37
Family Ribosomal protein L6 0.0000307
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.66e-23
Family Ribosomal protein L6 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110678743|ref|YP_681750.1|
Sequence length 177
Comment 50S ribosomal protein L6 [Roseobacter denitrificans OCh 114]
Sequence
MSRIGKKPVDLPAGVSASVSGQTIEIKGPKGTRAFKATDDVTLTVEDNVVTVTPRGKSKR
ARQQWGMSRTMVANLVTGVSEGFKKELEIQGVGYRAAMTGNTLKLNLGLSHDVDYTPPAG
VTVTAPKQTEIVVEGIDEQLVGQVAANIRQWRKPEPYKGKGIRYKGEFVFRKEGKKK
Download sequence
Identical sequences Q16AC9
gi|110678743|ref|YP_681750.1| WP_011567684.1.1045 WP_011567684.1.29122 375451.RD1_1425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]