SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110678141|ref|YP_681148.1| from Roseobacter denitrificans OCh 114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110678141|ref|YP_681148.1|
Domain Number 1 Region: 459-572
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-16
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110678141|ref|YP_681148.1|
Sequence length 581
Comment sulfate transporter permease [Roseobacter denitrificans OCh 114]
Sequence
MDRTMTHPLRRYMPVFDWGRTYDRKAFSNDMIAAVIVTIMLIPQSLAYALLAGLPPEAGI
YASIAPIVLYALFGTSRALAVGPVAVVSLLTASAIGQVAEQGTAGYAIAALTLAFLSGGF
LVLMGVFRLGFLANFLSHPVIAGFITASGILIATSQLKHILGVSAHGHTLPEILLAIGAH
LNEVNWITVIIGATATAFLFWVRKGLKPFLTRLGASATMADIATKAGPVVAVVGTTVAVW
AFDLAGQGVKIVGEVPQSLPPLTLPGFSLDLLQALLVPAILISIIGFVESVSVAQTLAAK
KRQCINPDQELIGLGAANLGAAFTGGYPVTGGFARSVVNFDAGAETPAAGAFTAIGLAIA
AVSLTPLVFFLPNATLAATIIVAVLSLVDLSILKKTWAYSRADFTAVAATIVLTLTLGVE
VGVAAGVITSVLLHLYKTSRPHVAEVGRVPGSEHFRNILRHEVETDPRVLCLRVDESLYF
VNARFLEDLIQSRVIEGCSIAHVVLMFSAVNEVDYSALESLEAVNARLKDMDVGLHLSEV
KGPVMDRLKRSHLIDDLNGQIFLSQNDAWTTLADHPRAAAE
Download sequence
Identical sequences Q16C31
375451.RD1_0783 gi|110678141|ref|YP_681148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]