SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110681349|ref|YP_684356.1| from Roseobacter denitrificans OCh 114

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110681349|ref|YP_684356.1|
Domain Number 1 Region: 229-760
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.49e-196
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000394
Further Details:      
 
Domain Number 2 Region: 774-917
Classification Level Classification E-value
Superfamily ADC-like 1.09e-43
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.00048
Further Details:      
 
Domain Number 3 Region: 5-126
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.47e-31
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.017
Further Details:      
 
Domain Number 4 Region: 136-216
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.35e-16
Family Archaeal ferredoxins 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110681349|ref|YP_684356.1|
Sequence length 925
Comment formate dehydrogenase subunit alpha [Roseobacter denitrificans OCh 114]
Sequence
MSESITFTLNGKTVTAAPGETIWEVANGRGLKIPHLCHKPAPGYRPDGNCRACMVEIEGE
RVLAASCIREPSEGMVVTTDTHRAESARKMVMELLLADQPEREVAHDKSSHLWDMADENG
IDVSRFPKLEEGRIPLLDDSHVAMSVNLDACIQCGLCVRACRDVQVNDVIGMAGRGHDAY
PTFDFADPMGESTCVACGECVQACPTGALMPSTVVDTDQVGDSADFDSETESVCPFCGVG
CKVSLKVKDGKVKYVEGINGPANEGRLCVKGRFGFDYIHHEHRLTKPLIRREDAPPKGLN
VDPGNLLTHFREATWEEAMEAAAGGLAKLRQAHGGQSVAGFGSAKCTNEEAYLFQKLIRQ
GFKHNNVDHCTRLCHASSVAALIENVGSGAVTATFNEIENADVAIVIGANPVENHPVAAT
YFKQFTKRGGKLIVMDPRGQGLKRFASHMLQFRPGADVSMLNAIMNVIVEENLYDQQYIE
AYTENWEAEKEHLKAFTPEAMEPICGIAPEVIRDVARTFAGANAAMIFWGMGVSQHIHGT
DNSRCLISLALMTGQVGRPGSGLHPLRGQNNVQGASDAGLIPMFLPDYRSVTDPEVREDI
FGVWGRDEDWSDQKGLTVTEIVDQVYAGNIKGMYIQGENPAMSDPDVDHAREAFAKLEHL
VVQDIFLTETACFADVILPASALYEKNGTVSNTNRQVQRVRPAVPPPGEAREDWAITVEL
AQRLGLPWEYTDVSQVFDEMKQVMPSLDNITWERLKTETVTYPSLSETDPGQAVVFGDGF
PRPDGRARFTPASVIPPDEAPDTEYPMIMTTGRQLEHWHTGSMTRRASVLDAVEPEANCS
LHPKTLRRLGVEPGDMVRLTTRRGSIDIMARSDRAVSEDMVFVPFAYVEAAANVLTNPAI
DPYGKIPEFKFAAVRVEAITRVAAE
Download sequence
Identical sequences Q160C3
gi|110681349|ref|YP_684356.1| 375451.RD1_4234 WP_011570280.1.1045 WP_011570280.1.29122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]