SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116617838|ref|YP_818209.1| from Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116617838|ref|YP_818209.1|
Domain Number 1 Region: 6-194
Classification Level Classification E-value
Superfamily Formyltransferase 2.09e-57
Family Formyltransferase 0.0000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116617838|ref|YP_818209.1|
Sequence length 196
Comment phosphoribosylglycinamide formyltransferase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293]
Sequence
MVRKVKLAVFASGTGTNFQALNDAILQRNLNAEIVRLIVDKSTAGALNLAKLFGIPATAI
KYSNYETKIEAEQVIINQLKTDQVDGILLAGYMRILTPKLIDAYSGKIINLHPAMLPKFP
GRHSILDAFEAGVSETGVTVHFVDNGIDTGEIIAQEAVPILVNDTIDLLETRIHNVEHVL
YPNTLAKLIDEGVFLK
Download sequence
Identical sequences A0A0K9JHG7 Q03Y86
203120.LEUM_0726 WP_011679516.1.1089 WP_011679516.1.11862 WP_011679516.1.2517 WP_011679516.1.2837 WP_011679516.1.5496 WP_011679516.1.57476 WP_011679516.1.69199 WP_011679516.1.72536 WP_011679516.1.75789 WP_011679516.1.85340 gi|116617838|ref|YP_818209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]