SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116618608|ref|YP_818979.1| from Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116618608|ref|YP_818979.1|
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily Formyltransferase 4.19e-62
Family Formyltransferase 0.00000647
Further Details:      
 
Domain Number 2 Region: 219-310
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 9.81e-19
Family Post formyltransferase domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116618608|ref|YP_818979.1|
Sequence length 321
Comment methionyl-tRNA formyltransferase [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293]
Sequence
MTYSVVLMGTPSFAVPILEALLENNNYDVKAVVTQPDRPQGRKHTLTPSPVKVAALAQNV
PVLQPEKISGSPEMQQVIDINPDFIVTAAFGQFLPTKLLDAAKIAAVNTHASLLPKYRGG
APVHYAIMNGDKETGVSIMYMVKKMDAGDVIDTIKVPITSTDNVGTMFDKLSIAGRDLLL
KTLPKIATGNIDPVVQNEEEVTFSPNIPHDMQNLNFATETAQELDWHIRGLYPTHPAFVQ
VLDQRVKITDVTPLSELTAQEPGTIVEKSKKQLKVASANGTVVQINRLQPAGKSEMAISA
YLNGAGKDLEVGQKWATINER
Download sequence
Identical sequences A0A1X0V8I4 Q03W16
WP_011680186.1.39971 WP_011680186.1.56645 WP_011680186.1.67983 WP_011680186.1.69199 gi|116618608|ref|YP_818979.1| 203120.LEUM_1514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]