SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116050134|ref|YP_791049.1| from Pseudomonas aeruginosa UCBPP-PA14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116050134|ref|YP_791049.1|
Domain Number 1 Region: 6-129
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 4.84e-61
Family PA2201 N-terminal domain-like 0.000000273
Further Details:      
 
Domain Number 2 Region: 137-291
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 4.71e-44
Family PA2201 C-terminal domain-like 0.0000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116050134|ref|YP_791049.1|
Sequence length 294
Comment hypothetical protein PA14_36250 [Pseudomonas aeruginosa UCBPP-PA14]
Sequence
MHAFPLTLDNRLADALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQ
PFTAQGHAALENAWAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGA
ARDSLREQGEVDFETAPALAPRTGQYPFALQLLAMGVLLDAQELIPALVEEVLQFDTDRL
LDYLGAAALGLTSASEETFHPRPFGQLRAFFEEADGSDAQALAPYLQSQYREFFQLSPKA
QKKTRRLTGPYAWGWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARARGDA
Download sequence
Identical sequences A0A0C6FAN1 A0A0H2ZAU1 A0A157WNF9
WP_009315738.1.100278 WP_009315738.1.101269 WP_009315738.1.10248 WP_009315738.1.10575 WP_009315738.1.10895 WP_009315738.1.11318 WP_009315738.1.12150 WP_009315738.1.13085 WP_009315738.1.13718 WP_009315738.1.14251 WP_009315738.1.14615 WP_009315738.1.14815 WP_009315738.1.16751 WP_009315738.1.16811 WP_009315738.1.17108 WP_009315738.1.17177 WP_009315738.1.17223 WP_009315738.1.18156 WP_009315738.1.18157 WP_009315738.1.18440 WP_009315738.1.18508 WP_009315738.1.18907 WP_009315738.1.19089 WP_009315738.1.19199 WP_009315738.1.19351 WP_009315738.1.19640 WP_009315738.1.19718 WP_009315738.1.2012 WP_009315738.1.20825 WP_009315738.1.20880 WP_009315738.1.20890 WP_009315738.1.21039 WP_009315738.1.21096 WP_009315738.1.2530 WP_009315738.1.28078 WP_009315738.1.28757 WP_009315738.1.30563 WP_009315738.1.30615 WP_009315738.1.31457 WP_009315738.1.31655 WP_009315738.1.32359 WP_009315738.1.32821 WP_009315738.1.33047 WP_009315738.1.33294 WP_009315738.1.33438 WP_009315738.1.33833 WP_009315738.1.34556 WP_009315738.1.35442 WP_009315738.1.35641 WP_009315738.1.36064 WP_009315738.1.36267 WP_009315738.1.373 WP_009315738.1.37571 WP_009315738.1.37703 WP_009315738.1.38023 WP_009315738.1.38587 WP_009315738.1.39765 WP_009315738.1.40442 WP_009315738.1.40984 WP_009315738.1.41110 WP_009315738.1.41429 WP_009315738.1.42316 WP_009315738.1.42499 WP_009315738.1.42870 WP_009315738.1.43286 WP_009315738.1.43756 WP_009315738.1.43998 WP_009315738.1.44486 WP_009315738.1.44725 WP_009315738.1.45604 WP_009315738.1.45700 WP_009315738.1.46306 WP_009315738.1.46633 WP_009315738.1.48472 WP_009315738.1.48851 WP_009315738.1.49108 WP_009315738.1.49806 WP_009315738.1.51457 WP_009315738.1.51957 WP_009315738.1.52500 WP_009315738.1.52850 WP_009315738.1.55387 WP_009315738.1.55813 WP_009315738.1.56626 WP_009315738.1.57020 WP_009315738.1.57369 WP_009315738.1.58200 WP_009315738.1.58360 WP_009315738.1.58510 WP_009315738.1.58800 WP_009315738.1.58944 WP_009315738.1.59376 WP_009315738.1.60084 WP_009315738.1.60364 WP_009315738.1.60472 WP_009315738.1.61589 WP_009315738.1.62703 WP_009315738.1.63739 WP_009315738.1.64212 WP_009315738.1.64544 WP_009315738.1.6461 WP_009315738.1.64886 WP_009315738.1.65312 WP_009315738.1.65457 WP_009315738.1.65632 WP_009315738.1.66155 WP_009315738.1.6627 WP_009315738.1.68172 WP_009315738.1.68499 WP_009315738.1.68979 WP_009315738.1.70537 WP_009315738.1.71249 WP_009315738.1.72727 WP_009315738.1.72845 WP_009315738.1.72920 WP_009315738.1.74281 WP_009315738.1.74326 WP_009315738.1.74685 WP_009315738.1.74878 WP_009315738.1.75431 WP_009315738.1.75603 WP_009315738.1.76141 WP_009315738.1.76775 WP_009315738.1.78118 WP_009315738.1.78288 WP_009315738.1.79754 WP_009315738.1.8038 WP_009315738.1.80785 WP_009315738.1.80910 WP_009315738.1.80969 WP_009315738.1.81426 WP_009315738.1.81470 WP_009315738.1.81856 WP_009315738.1.81874 WP_009315738.1.81927 WP_009315738.1.82686 WP_009315738.1.83374 WP_009315738.1.83440 WP_009315738.1.83460 WP_009315738.1.83503 WP_009315738.1.83540 WP_009315738.1.84558 WP_009315738.1.84865 WP_009315738.1.85150 WP_009315738.1.85638 WP_009315738.1.86665 WP_009315738.1.86796 WP_009315738.1.86970 WP_009315738.1.8785 WP_009315738.1.87888 WP_009315738.1.88540 WP_009315738.1.89480 WP_009315738.1.91392 WP_009315738.1.92630 WP_009315738.1.93568 WP_009315738.1.93889 WP_009315738.1.94078 WP_009315738.1.94333 WP_009315738.1.95782 WP_009315738.1.96058 WP_009315738.1.961 WP_009315738.1.985 WP_009315738.1.98873 WP_009315738.1.98963 WP_009315738.1.99065 WP_009315738.1.99378 WP_009315738.1.99772 208963.PA14_36250 gi|116050134|ref|YP_791049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]