SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116051088|ref|YP_790081.1| from Pseudomonas aeruginosa UCBPP-PA14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116051088|ref|YP_790081.1|
Domain Number 1 Region: 4-366
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.3e-114
Family FMN-linked oxidoreductases 0.00000000232
Further Details:      
 
Domain Number 2 Region: 337-526
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 9.42e-43
Family N-terminal domain of adrenodoxin reductase-like 0.0000095
Further Details:      
 
Domain Number 3 Region: 466-524,562-657
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.46e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116051088|ref|YP_790081.1|
Sequence length 679
Comment 2,4-dienoyl-CoA reductase [Pseudomonas aeruginosa UCBPP-PA14]
Sequence
MTAAVPYPHLLAPLDLGFTTLRNRTLMGSMHTGLEEKPQGFERMAAYFAERARGGVGLMV
TGGIGPNEEGGVYSGAAKLSTPEEAEKHRIVTQAVHEAGGKICMQILHAGRYAYSPKQVA
PSAIQAPINPFKPKELDEEGIEKQIADFVNCASLAQVAGYDGVEIMGSEGYFINQFLVQH
TNQRTDRWGGSYENRMRLPVEIVRRVREAVGPNFIIIYRLSMLDLVEGGSSWDEIVLLAK
AVEKAGATLINTGIGWHEARIPTIATKVPRAAFTKVTAKLRGEVGIPLITTNRINTPEVA
EKVLAEGDADMVSMARPFLADPDFVNKAAAGHAERINTCIGCNQACLDHTFGGKLTSCLV
NPRACHETELNYIPTARPKKIAVVGAGPAGLAAATVAAERGHRVSLFDAAGEIGGQFNVA
KRVPGKEEFHETLRYFRNKLESTGVELHLNRRVGVDDLVAGGYDEIVLATGIVPRTPAIP
GIEHPKVISYLDAILERKPVGGKVAVIGAGGIGFDVSEFITHAGPSTSLEREAFWKQWGI
DTRLEARGGIAGVKAEVHPAARQVFLLQRKKSKVGDGLGKTTGWIHRAGLKNKQVQMVNA
VEYLGIDDAGLHIRVAEGEPQVLPVDTVIVCAGQDPLRELQDGLLAAGRSVHLIGGADVA
AELDAKRAINQGSRLAAEL
Download sequence
Identical sequences A0A0E1AQJ1 A0A0H2ZDE2 A0A157VPA7 A0A232DM26 V6AD18
208963.PA14_24170 WP_003091351.1.100278 WP_003091351.1.100469 WP_003091351.1.101590 WP_003091351.1.10174 WP_003091351.1.10248 WP_003091351.1.10271 WP_003091351.1.10575 WP_003091351.1.10895 WP_003091351.1.11130 WP_003091351.1.11318 WP_003091351.1.1183 WP_003091351.1.12150 WP_003091351.1.12547 WP_003091351.1.12660 WP_003091351.1.12890 WP_003091351.1.13077 WP_003091351.1.13085 WP_003091351.1.13092 WP_003091351.1.13270 WP_003091351.1.13364 WP_003091351.1.13533 WP_003091351.1.13642 WP_003091351.1.13718 WP_003091351.1.13743 WP_003091351.1.14116 WP_003091351.1.14251 WP_003091351.1.14476 WP_003091351.1.14525 WP_003091351.1.14679 WP_003091351.1.14690 WP_003091351.1.15408 WP_003091351.1.15666 WP_003091351.1.16751 WP_003091351.1.16811 WP_003091351.1.17108 WP_003091351.1.17177 WP_003091351.1.17189 WP_003091351.1.17223 WP_003091351.1.17499 WP_003091351.1.1761 WP_003091351.1.18156 WP_003091351.1.18157 WP_003091351.1.18440 WP_003091351.1.18508 WP_003091351.1.18732 WP_003091351.1.18795 WP_003091351.1.18907 WP_003091351.1.19089 WP_003091351.1.19199 WP_003091351.1.19351 WP_003091351.1.19640 WP_003091351.1.2012 WP_003091351.1.20590 WP_003091351.1.20692 WP_003091351.1.20825 WP_003091351.1.20880 WP_003091351.1.20890 WP_003091351.1.21253 WP_003091351.1.2237 WP_003091351.1.22390 WP_003091351.1.2374 WP_003091351.1.24234 WP_003091351.1.24382 WP_003091351.1.24413 WP_003091351.1.24626 WP_003091351.1.2530 WP_003091351.1.25641 WP_003091351.1.26862 WP_003091351.1.27549 WP_003091351.1.28078 WP_003091351.1.28699 WP_003091351.1.28757 WP_003091351.1.28878 WP_003091351.1.29008 WP_003091351.1.29070 WP_003091351.1.29127 WP_003091351.1.29650 WP_003091351.1.29958 WP_003091351.1.30020 WP_003091351.1.3030 WP_003091351.1.30563 WP_003091351.1.30615 WP_003091351.1.30842 WP_003091351.1.30943 WP_003091351.1.31457 WP_003091351.1.31563 WP_003091351.1.31633 WP_003091351.1.31655 WP_003091351.1.31751 WP_003091351.1.32235 WP_003091351.1.32359 WP_003091351.1.32626 WP_003091351.1.33009 WP_003091351.1.33047 WP_003091351.1.33294 WP_003091351.1.33438 WP_003091351.1.33441 WP_003091351.1.33669 WP_003091351.1.33728 WP_003091351.1.33833 WP_003091351.1.33945 WP_003091351.1.34150 WP_003091351.1.34461 WP_003091351.1.34465 WP_003091351.1.34556 WP_003091351.1.35442 WP_003091351.1.35529 WP_003091351.1.3555 WP_003091351.1.35968 WP_003091351.1.36064 WP_003091351.1.36267 WP_003091351.1.36285 WP_003091351.1.36708 WP_003091351.1.373 WP_003091351.1.3742 WP_003091351.1.37571 WP_003091351.1.38023 WP_003091351.1.38335 WP_003091351.1.38582 WP_003091351.1.38816 WP_003091351.1.39765 WP_003091351.1.39920 WP_003091351.1.40271 WP_003091351.1.40442 WP_003091351.1.40984 WP_003091351.1.41110 WP_003091351.1.41137 WP_003091351.1.41199 WP_003091351.1.41429 WP_003091351.1.41703 WP_003091351.1.4196 WP_003091351.1.42 WP_003091351.1.42047 WP_003091351.1.42316 WP_003091351.1.42411 WP_003091351.1.42499 WP_003091351.1.42690 WP_003091351.1.42723 WP_003091351.1.4273 WP_003091351.1.42870 WP_003091351.1.43212 WP_003091351.1.43286 WP_003091351.1.43326 WP_003091351.1.43756 WP_003091351.1.43998 WP_003091351.1.44269 WP_003091351.1.44486 WP_003091351.1.44552 WP_003091351.1.44725 WP_003091351.1.44804 WP_003091351.1.44870 WP_003091351.1.45353 WP_003091351.1.45604 WP_003091351.1.45635 WP_003091351.1.45678 WP_003091351.1.45700 WP_003091351.1.45946 WP_003091351.1.46306 WP_003091351.1.4640 WP_003091351.1.47551 WP_003091351.1.48472 WP_003091351.1.48579 WP_003091351.1.48747 WP_003091351.1.48840 WP_003091351.1.48851 WP_003091351.1.49108 WP_003091351.1.49244 WP_003091351.1.49806 WP_003091351.1.50450 WP_003091351.1.50459 WP_003091351.1.50783 WP_003091351.1.50922 WP_003091351.1.51928 WP_003091351.1.51957 WP_003091351.1.52372 WP_003091351.1.52403 WP_003091351.1.52500 WP_003091351.1.52591 WP_003091351.1.52850 WP_003091351.1.5289 WP_003091351.1.52939 WP_003091351.1.53586 WP_003091351.1.53946 WP_003091351.1.53951 WP_003091351.1.54003 WP_003091351.1.54076 WP_003091351.1.54354 WP_003091351.1.55 WP_003091351.1.55387 WP_003091351.1.55813 WP_003091351.1.56626 WP_003091351.1.56864 WP_003091351.1.57020 WP_003091351.1.57065 WP_003091351.1.57369 WP_003091351.1.57853 WP_003091351.1.57921 WP_003091351.1.58200 WP_003091351.1.58360 WP_003091351.1.58510 WP_003091351.1.58581 WP_003091351.1.58800 WP_003091351.1.58944 WP_003091351.1.5897 WP_003091351.1.59339 WP_003091351.1.59385 WP_003091351.1.59943 WP_003091351.1.60079 WP_003091351.1.60084 WP_003091351.1.60472 WP_003091351.1.60679 WP_003091351.1.60850 WP_003091351.1.60970 WP_003091351.1.61288 WP_003091351.1.616 WP_003091351.1.626 WP_003091351.1.62703 WP_003091351.1.62961 WP_003091351.1.63739 WP_003091351.1.63929 WP_003091351.1.63941 WP_003091351.1.64544 WP_003091351.1.64605 WP_003091351.1.6461 WP_003091351.1.64611 WP_003091351.1.64886 WP_003091351.1.65312 WP_003091351.1.65457 WP_003091351.1.65478 WP_003091351.1.65632 WP_003091351.1.66088 WP_003091351.1.66155 WP_003091351.1.66693 WP_003091351.1.67124 WP_003091351.1.67874 WP_003091351.1.67875 WP_003091351.1.67899 WP_003091351.1.67937 WP_003091351.1.6796 WP_003091351.1.68172 WP_003091351.1.68446 WP_003091351.1.68448 WP_003091351.1.68499 WP_003091351.1.68979 WP_003091351.1.70138 WP_003091351.1.70537 WP_003091351.1.70650 WP_003091351.1.71203 WP_003091351.1.71249 WP_003091351.1.71254 WP_003091351.1.71290 WP_003091351.1.71610 WP_003091351.1.7163 WP_003091351.1.71862 WP_003091351.1.7219 WP_003091351.1.72662 WP_003091351.1.72782 WP_003091351.1.72920 WP_003091351.1.73035 WP_003091351.1.74281 WP_003091351.1.74287 WP_003091351.1.74326 WP_003091351.1.74685 WP_003091351.1.74878 WP_003091351.1.7501 WP_003091351.1.75389 WP_003091351.1.75431 WP_003091351.1.75603 WP_003091351.1.7568 WP_003091351.1.75756 WP_003091351.1.76077 WP_003091351.1.76141 WP_003091351.1.76775 WP_003091351.1.76861 WP_003091351.1.77442 WP_003091351.1.78118 WP_003091351.1.78288 WP_003091351.1.7840 WP_003091351.1.78425 WP_003091351.1.78599 WP_003091351.1.7899 WP_003091351.1.79003 WP_003091351.1.79060 WP_003091351.1.79754 WP_003091351.1.8038 WP_003091351.1.80683 WP_003091351.1.80715 WP_003091351.1.80785 WP_003091351.1.80926 WP_003091351.1.81338 WP_003091351.1.81349 WP_003091351.1.8141 WP_003091351.1.81426 WP_003091351.1.81470 WP_003091351.1.81856 WP_003091351.1.81874 WP_003091351.1.81927 WP_003091351.1.8238 WP_003091351.1.82798 WP_003091351.1.82810 WP_003091351.1.83267 WP_003091351.1.83440 WP_003091351.1.83460 WP_003091351.1.83503 WP_003091351.1.8351 WP_003091351.1.83540 WP_003091351.1.83871 WP_003091351.1.83937 WP_003091351.1.84178 WP_003091351.1.84558 WP_003091351.1.84684 WP_003091351.1.84825 WP_003091351.1.85150 WP_003091351.1.85638 WP_003091351.1.85920 WP_003091351.1.85978 WP_003091351.1.86182 WP_003091351.1.86243 WP_003091351.1.8645 WP_003091351.1.86506 WP_003091351.1.86595 WP_003091351.1.86665 WP_003091351.1.86796 WP_003091351.1.86970 WP_003091351.1.8785 WP_003091351.1.87888 WP_003091351.1.87975 WP_003091351.1.88415 WP_003091351.1.88540 WP_003091351.1.889 WP_003091351.1.89480 WP_003091351.1.89992 WP_003091351.1.90272 WP_003091351.1.91012 WP_003091351.1.91236 WP_003091351.1.91281 WP_003091351.1.91392 WP_003091351.1.91467 WP_003091351.1.91882 WP_003091351.1.92630 WP_003091351.1.93196 WP_003091351.1.93520 WP_003091351.1.93568 WP_003091351.1.93889 WP_003091351.1.94065 WP_003091351.1.94078 WP_003091351.1.94288 WP_003091351.1.94333 WP_003091351.1.94881 WP_003091351.1.95354 WP_003091351.1.95782 WP_003091351.1.96058 WP_003091351.1.961 WP_003091351.1.96863 WP_003091351.1.97204 WP_003091351.1.97503 WP_003091351.1.97521 WP_003091351.1.97784 WP_003091351.1.985 WP_003091351.1.98873 WP_003091351.1.99065 WP_003091351.1.99378 WP_003091351.1.99647 WP_003091351.1.99772 gi|116051088|ref|YP_790081.1| gi|564951775|ref|YP_008884345.1| gi|386067126|ref|YP_005982430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]